BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001081-TA|BGIBMGA001081-PA|IPR003307|eIF4- gamma/eIF5/eIF2-epsilon (60 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1184 + 34802749-34802892,34802981-34803220,34803636-348039... 33 0.029 03_05_0814 + 27907158-27907368,27907981-27908270,27910250-279104... 25 5.8 >02_05_1184 + 34802749-34802892,34802981-34803220,34803636-34803950, 34804030-34804209,34804312-34804504,34805062-34805324, 34805461-34805590,34805719-34805786,34805951-34806199, 34806284-34806357,34808052-34808143,34808603-34808685, 34810337-34810408,34810558-34810683,34810996-34811037 Length = 756 Score = 33.1 bits (72), Expect = 0.029 Identities = 15/41 (36%), Positives = 22/41 (53%) Query: 8 YLYNMEVCEEEAFLRWREDVTDAYPGKGEALFQVNTWLTWL 48 YLY+ EV E+A LRW E+ +A + Q ++ WL Sbjct: 705 YLYDKEVVSEDAILRWAEEKENADESDKVFVKQSEAFIQWL 745 >03_05_0814 + 27907158-27907368,27907981-27908270,27910250-27910493, 27910589-27910927,27911036-27911121,27911218-27911325, 27911471-27911778,27911864-27912127,27912227-27913010 Length = 877 Score = 25.4 bits (53), Expect = 5.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Query: 29 DAYPGKGEALFQVNTWL 45 D PGKG +F N+W+ Sbjct: 135 DGVPGKGTVVFVANSWI 151 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.327 0.140 0.503 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,660,277 Number of Sequences: 37544 Number of extensions: 41937 Number of successful extensions: 96 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 94 Number of HSP's gapped (non-prelim): 2 length of query: 60 length of database: 14,793,348 effective HSP length: 40 effective length of query: 20 effective length of database: 13,291,588 effective search space: 265831760 effective search space used: 265831760 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -