BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001081-TA|BGIBMGA001081-PA|IPR003307|eIF4- gamma/eIF5/eIF2-epsilon (60 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U64857-14|AAL16313.1| 402|Caenorhabditis elegans Hypothetical p... 29 0.51 U64857-13|AAC25859.2| 436|Caenorhabditis elegans Hypothetical p... 29 0.51 U64857-12|AAN84849.1| 413|Caenorhabditis elegans Hypothetical p... 29 0.51 AL110500-5|CAB60428.1| 1050|Caenorhabditis elegans Hypothetical ... 27 1.6 AF003143-2|AAK68267.2| 554|Caenorhabditis elegans Hypothetical ... 25 8.3 >U64857-14|AAL16313.1| 402|Caenorhabditis elegans Hypothetical protein C37C3.2b protein. Length = 402 Score = 28.7 bits (61), Expect = 0.51 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 9 LYNMEVCEEEAFLRWREDVTDAYPGKGEA 37 LY+ +VCEE++ + W E + Y K A Sbjct: 293 LYDEDVCEEDSLISWGEKPSSKYVSKSFA 321 >U64857-13|AAC25859.2| 436|Caenorhabditis elegans Hypothetical protein C37C3.2a protein. Length = 436 Score = 28.7 bits (61), Expect = 0.51 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 9 LYNMEVCEEEAFLRWREDVTDAYPGKGEA 37 LY+ +VCEE++ + W E + Y K A Sbjct: 327 LYDEDVCEEDSLISWGEKPSSKYVSKSFA 355 >U64857-12|AAN84849.1| 413|Caenorhabditis elegans Hypothetical protein C37C3.2c protein. Length = 413 Score = 28.7 bits (61), Expect = 0.51 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 9 LYNMEVCEEEAFLRWREDVTDAYPGKGEA 37 LY+ +VCEE++ + W E + Y K A Sbjct: 327 LYDEDVCEEDSLISWGEKPSSKYVSKSFA 355 >AL110500-5|CAB60428.1| 1050|Caenorhabditis elegans Hypothetical protein Y87G2A.5 protein. Length = 1050 Score = 27.1 bits (57), Expect = 1.6 Identities = 13/32 (40%), Positives = 16/32 (50%) Query: 13 EVCEEEAFLRWREDVTDAYPGKGEALFQVNTW 44 +V E E L+W EDV D + G F V W Sbjct: 552 QVPEAEILLKWDEDVLDTWFSSGMWPFAVFGW 583 >AF003143-2|AAK68267.2| 554|Caenorhabditis elegans Hypothetical protein C53H9.2a protein. Length = 554 Score = 24.6 bits (51), Expect = 8.3 Identities = 8/14 (57%), Positives = 12/14 (85%) Query: 16 EEEAFLRWREDVTD 29 E EAFL+WR D+++ Sbjct: 139 ENEAFLQWRSDLSE 152 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.327 0.140 0.503 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,348,631 Number of Sequences: 27539 Number of extensions: 33533 Number of successful extensions: 87 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 82 Number of HSP's gapped (non-prelim): 5 length of query: 60 length of database: 12,573,161 effective HSP length: 41 effective length of query: 19 effective length of database: 11,444,062 effective search space: 217437178 effective search space used: 217437178 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -