BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001078-TA|BGIBMGA001078-PA|undefined (158 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. 24 2.6 >DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. Length = 494 Score = 23.8 bits (49), Expect = 2.6 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 33 DYRPPEGTPAPNHTVPARASTINFQ-GLPGTKYHFML 68 DY EG PAP V A+ I +Q LP + + ML Sbjct: 185 DYEDGEGGPAPKSQVIRVANGIFYQKDLPMRQQYVML 221 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.318 0.135 0.411 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,710 Number of Sequences: 2123 Number of extensions: 7861 Number of successful extensions: 11 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 11 Number of HSP's gapped (non-prelim): 1 length of query: 158 length of database: 516,269 effective HSP length: 59 effective length of query: 99 effective length of database: 391,012 effective search space: 38710188 effective search space used: 38710188 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -