GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001078-TA|BGIBMGA001078-PA|undefined
         (158 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ974166-1|ABJ52806.1|  494|Anopheles gambiae serpin 6 protein.        24   2.6  

>DQ974166-1|ABJ52806.1|  494|Anopheles gambiae serpin 6 protein.
          Length = 494

 Score = 23.8 bits (49), Expect = 2.6
 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 33  DYRPPEGTPAPNHTVPARASTINFQ-GLPGTKYHFML 68
           DY   EG PAP   V   A+ I +Q  LP  + + ML
Sbjct: 185 DYEDGEGGPAPKSQVIRVANGIFYQKDLPMRQQYVML 221


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.318    0.135    0.411 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 183,710
Number of Sequences: 2123
Number of extensions: 7861
Number of successful extensions: 11
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 11
Number of HSP's gapped (non-prelim): 1
length of query: 158
length of database: 516,269
effective HSP length: 59
effective length of query: 99
effective length of database: 391,012
effective search space: 38710188
effective search space used: 38710188
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 45 (22.2 bits)