BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001068-TA|BGIBMGA001068-PA|IPR002529|Fumarylacetoacetate (FAA) hydrolase (285 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 26 0.28 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 26 0.28 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 26 0.28 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 21 7.9 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 21 7.9 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 21 7.9 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 21 7.9 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 26.2 bits (55), Expect = 0.28 Identities = 12/37 (32%), Positives = 18/37 (48%) Query: 64 ITLKAPVHGNDKVLCVGLNYKDHCEEQKLTPPELPFI 100 I L PV + + G+ Y+D C + PP L F+ Sbjct: 166 INLSVPVLLSGLIAMCGMYYRDECSFAESIPPYLFFV 202 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 26.2 bits (55), Expect = 0.28 Identities = 12/37 (32%), Positives = 18/37 (48%) Query: 64 ITLKAPVHGNDKVLCVGLNYKDHCEEQKLTPPELPFI 100 I L PV + + G+ Y+D C + PP L F+ Sbjct: 399 INLSVPVLLSGLIAMCGMYYRDECSFAESIPPYLFFV 435 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 26.2 bits (55), Expect = 0.28 Identities = 12/37 (32%), Positives = 18/37 (48%) Query: 64 ITLKAPVHGNDKVLCVGLNYKDHCEEQKLTPPELPFI 100 I L PV + + G+ Y+D C + PP L F+ Sbjct: 399 INLSVPVLLSGLIAMCGMYYRDECSFAESIPPYLFFV 435 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 255 YRNPPEFLQPGDVIT 269 YR+ P F QP ++T Sbjct: 119 YRDEPRFSQPHQILT 133 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 255 YRNPPEFLQPGDVIT 269 YR+ P F QP ++T Sbjct: 279 YRDEPRFSQPHQILT 293 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 255 YRNPPEFLQPGDVIT 269 YR+ P F QP ++T Sbjct: 279 YRDEPRFSQPHQILT 293 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 89 EQKLTPPELPFIFNK 103 E+ TPP LP ++ K Sbjct: 135 EKPYTPPRLPTVYGK 149 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.138 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,770 Number of Sequences: 317 Number of extensions: 2762 Number of successful extensions: 14 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 7 length of query: 285 length of database: 114,650 effective HSP length: 56 effective length of query: 229 effective length of database: 96,898 effective search space: 22189642 effective search space used: 22189642 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -