BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001068-TA|BGIBMGA001068-PA|IPR002529|Fumarylacetoacetate (FAA) hydrolase (285 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15940.1 68417.m02420 fumarylacetoacetate hydrolase family pr... 118 3e-27 At3g16700.1 68416.m02133 fumarylacetoacetate hydrolase family pr... 111 4e-25 At3g11010.1 68416.m01329 disease resistance family protein / LRR... 30 1.5 At3g53380.1 68416.m05891 lectin protein kinase family protein co... 30 2.0 At1g69770.1 68414.m08028 chromomethylase 3 (CMT3) nearly identic... 30 2.0 At5g58420.1 68418.m07315 40S ribosomal protein S4 (RPS4D) riboso... 29 3.6 At2g48050.1 68415.m06014 expressed protein ; expression supporte... 29 3.6 At5g27060.1 68418.m03229 disease resistance family protein conta... 29 4.7 At2g17036.1 68415.m01966 F-box family protein ; similar to SKP1... 29 4.7 At1g72110.1 68414.m08335 expressed protein 29 4.7 At5g07090.1 68418.m00804 40S ribosomal protein S4 (RPS4B) 28 6.2 At2g17360.1 68415.m02005 40S ribosomal protein S4 (RPS4A) contai... 28 6.2 At5g46330.1 68418.m05703 leucine-rich repeat transmembrane prote... 28 8.2 At4g02350.1 68417.m00319 exocyst complex subunit Sec15-like fami... 28 8.2 At3g24240.1 68416.m03042 leucine-rich repeat transmembrane prote... 28 8.2 At1g74600.1 68414.m08641 pentatricopeptide (PPR) repeat-containi... 28 8.2 >At4g15940.1 68417.m02420 fumarylacetoacetate hydrolase family protein contains Pfam domain, PF01557: fumarylacetoacetate hydrolase family protein Length = 222 Score = 118 bits (285), Expect = 3e-27 Identities = 69/181 (38%), Positives = 105/181 (58%), Gaps = 5/181 (2%) Query: 75 KVLCVGLNYKDHCEEQKLTPPELPFIFNKFPSTVVGPNDTIKLKMDVSKAVVCEIELTVV 134 K++CVG NY H +E P+ P IF K S+ + TI++ + ++ E+EL +V Sbjct: 15 KIVCVGRNYAAHAKELGNAVPKEPVIFLKPTSSYLENGGTIEIPHPLD-SLHHEVELALV 73 Query: 135 IGKKASKVDSSHAFDYVLGYTIAQDIGATDWEKNKKISQL--LLGKAMDTFCPIGPWIVT 192 IG+KA V S A DY+ GY +A D+ A + + + K S L + K DTF PI ++ Sbjct: 74 IGQKARDVPESIAMDYIGGYAVALDMTARELQASAKASGLPWTVAKGQDTFTPISS-VLP 132 Query: 193 SDEIGNPQNLNVKCSINGVQKQKSNTNQFIHKIPDIIARLSNVMTLLPGDIILTGTPGGV 252 + +P NL + ++G +QK T I K+P +I+ +S++MTL GD+ILTGTP GV Sbjct: 133 KAMVRDPDNLELWLKVDGETRQKGLTKDMIFKVPYLISYISSIMTLY-GDVILTGTPEGV 191 Query: 253 G 253 G Sbjct: 192 G 192 >At3g16700.1 68416.m02133 fumarylacetoacetate hydrolase family protein contains Pfam domain, PF01557: fumarylacetoacetate hydrolase family protein Length = 224 Score = 111 bits (268), Expect = 4e-25 Identities = 66/181 (36%), Positives = 102/181 (56%), Gaps = 4/181 (2%) Query: 75 KVLCVGLNYKDHCEEQKLTPPELPFIFNKFPSTVVGPNDTIKLKMDVSKAVVCEIELTVV 134 K++ VGLNY H +E P+ P +F K S+ + TI++ + ++ E+EL VV Sbjct: 15 KIVGVGLNYASHAKELGNALPKDPIVFLKPTSSYLENGGTIEIPHPLD-SLHHEVELAVV 73 Query: 135 IGKKASKVDSSHAFDYVLGYTIAQDIGATDWEKNKKISQL--LLGKAMDTFCPIGPWIVT 192 IG+KA V A +Y+ GY +A D+ A + + + S L L K DTF PI ++ Sbjct: 74 IGQKARDVPERLAMNYIGGYALALDMTARELQVSAMASGLPCTLAKGQDTFTPISS-VLP 132 Query: 193 SDEIGNPQNLNVKCSINGVQKQKSNTNQFIHKIPDIIARLSNVMTLLPGDIILTGTPGGV 252 + +P NL + ++ +QK T I K+P +I+ +S+VMTL GD+ILTGTP G+ Sbjct: 133 KAMVLDPNNLELWLKVDDETRQKGWTKDMIFKVPYLISYISSVMTLFKGDVILTGTPEGI 192 Query: 253 G 253 G Sbjct: 193 G 193 >At3g11010.1 68416.m01329 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to disease resistance protein [Lycopersicon esculentum] gi|3894383|gb|AAC78591 Length = 894 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/46 (32%), Positives = 22/46 (47%) Query: 203 NVKCSINGVQKQKSNTNQFIHKIPDIIARLSNVMTLLPGDIILTGT 248 NV ++ G+ + N+F +P I LSN+M D TGT Sbjct: 244 NVLLNLTGLSVVSLSNNKFTGTLPPNITSLSNLMAFYASDNAFTGT 289 >At3g53380.1 68416.m05891 lectin protein kinase family protein contains Pfam domains, PF00069: Protein kinase domain, PF00138: Legume lectins alpha domain, and PF00139: Legume lectins beta domain Length = 715 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/49 (32%), Positives = 24/49 (48%) Query: 230 ARLSNVMTLLPGDIILTGTPGGVGVYRNPPEFLQPGDVITSEIENIGTF 278 ARLSN + L D+ + + G +Y NP F QPG + + +F Sbjct: 40 ARLSNGIVGLTRDLSVPNSGAGKVLYSNPIRFRQPGTHFPTSFSSFFSF 88 >At1g69770.1 68414.m08028 chromomethylase 3 (CMT3) nearly identical to chromomethylase CMT3 [Arabidopsis thaliana] GI:14583092, GI:14647157 Length = 839 Score = 29.9 bits (64), Expect = 2.0 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 8/66 (12%) Query: 79 VGLNYKDHCEEQKLTPPELPFIFNKFPSTVVGPNDTIKL-------KMDVSKAVVCEIEL 131 + LN D+ E P F FP +VGP + +KL K++ K +V + L Sbjct: 661 LNLNINDY-ERVCQVPKRKGANFRDFPGVIVGPGNVVKLEEGKERVKLESGKTLVPDYAL 719 Query: 132 TVVIGK 137 T V GK Sbjct: 720 TYVDGK 725 >At5g58420.1 68418.m07315 40S ribosomal protein S4 (RPS4D) ribosomal protein S4, Arabidopsis thaliana, PIR:T48480 Length = 262 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/23 (43%), Positives = 17/23 (73%) Query: 103 KFPSTVVGPNDTIKLKMDVSKAV 125 ++P ++ PNDTIKL ++ +K V Sbjct: 148 RYPDPLIKPNDTIKLDLEANKIV 170 >At2g48050.1 68415.m06014 expressed protein ; expression supported by MPSS Length = 1500 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Query: 122 SKAVVCEIELTVVIGKKASKVDSSHAFDYVLGYTIAQDIGATDWEKNKKISQ 173 +++ + EI + +++ + S + SS FDYV Y A+ IGA E+ KK ++ Sbjct: 700 ARSALVEIIIFMLVSLQ-SYMFSSQEFDYVSRYLEAEQIGAIVREQEKKAAR 750 >At5g27060.1 68418.m03229 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-0B [Lycopersicon esculentum] gi|3894387|gb|AAC78593 Length = 957 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/46 (32%), Positives = 22/46 (47%) Query: 203 NVKCSINGVQKQKSNTNQFIHKIPDIIARLSNVMTLLPGDIILTGT 248 NV ++ G+ + N+F +P I LSN+M D TGT Sbjct: 307 NVLLNLTGLSLLSLSNNKFTGTLPPNITSLSNLMDFDASDNAFTGT 352 >At2g17036.1 68415.m01966 F-box family protein ; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 428 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/46 (32%), Positives = 22/46 (47%) Query: 158 QDIGATDWEKNKKISQLLLGKAMDTFCPIGPWIVTSDEIGNPQNLN 203 +++G D+ K L + F P PWI TS E+ Q+LN Sbjct: 351 RNLGVFDFRSGKTELVNKLPEYAKLFWPPPPWITTSHEVSGFQSLN 396 >At1g72110.1 68414.m08335 expressed protein Length = 479 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/62 (25%), Positives = 27/62 (43%), Gaps = 2/62 (3%) Query: 217 NTNQFIHKIP--DIIARLSNVMTLLPGDIILTGTPGGVGVYRNPPEFLQPGDVITSEIEN 274 + N+FIH+I D + + N M + D++ G+ Y N L+ + N Sbjct: 231 SANKFIHRIISLDDVKMVKNAMNMTVNDVLFGMVQAGLSRYLNQRYDLETSSKSRKNLHN 290 Query: 275 IG 276 IG Sbjct: 291 IG 292 >At5g07090.1 68418.m00804 40S ribosomal protein S4 (RPS4B) Length = 262 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/23 (43%), Positives = 17/23 (73%) Query: 103 KFPSTVVGPNDTIKLKMDVSKAV 125 ++P ++ PNDTIKL ++ +K V Sbjct: 148 RYPDPLIKPNDTIKLDLEENKIV 170 >At2g17360.1 68415.m02005 40S ribosomal protein S4 (RPS4A) contains ribosomal protein S4 signature from residues 8 to 22 Length = 261 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/23 (43%), Positives = 17/23 (73%) Query: 103 KFPSTVVGPNDTIKLKMDVSKAV 125 ++P ++ PNDTIKL ++ +K V Sbjct: 148 RYPDPLIKPNDTIKLDLEENKIV 170 >At5g46330.1 68418.m05703 leucine-rich repeat transmembrane protein kinase, putative Length = 1173 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/30 (50%), Positives = 17/30 (56%) Query: 219 NQFIHKIPDIIARLSNVMTLLPGDIILTGT 248 N F +IPD I SN+ TL D LTGT Sbjct: 441 NHFTGEIPDDIFNCSNLETLSVADNNLTGT 470 >At4g02350.1 68417.m00319 exocyst complex subunit Sec15-like family protein contains Pfam profile PF04091: Exocyst complex subunit Sec15-like Length = 771 Score = 27.9 bits (59), Expect = 8.2 Identities = 19/77 (24%), Positives = 40/77 (51%), Gaps = 7/77 (9%) Query: 169 KKISQLLLGKAMDTFCPIGPWIVTSDEIGNPQNL--NVKCSINGVQKQ-----KSNTNQF 221 +K+ +LL+ A+ +GP++ + G P+ L ++K + + K++ F Sbjct: 23 EKLDELLISSAICNGEDLGPFVRKTFGTGKPETLLHHLKFFARSKESEIEEVCKAHYQDF 82 Query: 222 IHKIPDIIARLSNVMTL 238 IH + D+ + LS+V +L Sbjct: 83 IHAVDDLKSLLSDVESL 99 >At3g24240.1 68416.m03042 leucine-rich repeat transmembrane protein kinase, putative similar to CLV1 receptor kinase GB:AAB58929 from [Arabidopsis thaliana] Length = 1141 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/32 (40%), Positives = 21/32 (65%) Query: 217 NTNQFIHKIPDIIARLSNVMTLLPGDIILTGT 248 N+NQ KIP I++ S + +L+ D +LTG+ Sbjct: 161 NSNQLTGKIPPDISKCSKLKSLILFDNLLTGS 192 >At1g74600.1 68414.m08641 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 895 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Query: 128 EIELTVVIGKKASKVDSSHAFDYVLGYTIAQDIGATDWEKNKKISQLLLG 177 E+EL V KKA +++ S A Y+ I ++G +W++ ++ +L+ G Sbjct: 836 EVELGKVAAKKAIELEPSDAGAYISLSNILAEVG--EWDEVEETRKLMKG 883 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.317 0.138 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,822,117 Number of Sequences: 28952 Number of extensions: 280236 Number of successful extensions: 698 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 673 Number of HSP's gapped (non-prelim): 24 length of query: 285 length of database: 12,070,560 effective HSP length: 80 effective length of query: 205 effective length of database: 9,754,400 effective search space: 1999652000 effective search space used: 1999652000 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -