BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001067-TA|BGIBMGA001067-PA|undefined (272 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0629 + 26248960-26249236,26249766-26249894,26250291-262508... 30 2.3 02_01_0344 + 2467191-2468282 29 5.3 03_05_0944 + 29046793-29046922,29048091-29048464,29048556-290486... 28 7.0 02_01_0252 - 1657268-1657692,1657727-1658445,1658761-1659089,165... 28 7.0 12_02_0226 + 15887835-15891188 28 9.2 >03_05_0629 + 26248960-26249236,26249766-26249894,26250291-26250847, 26250933-26251250 Length = 426 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/81 (24%), Positives = 38/81 (46%), Gaps = 8/81 (9%) Query: 13 NSFIVFSNTFLHYEKNVQMFKSLCS-----IDELMKIVRLEHRDLK--LFIAIILLLSST 65 N I F + +LH+++ + L S I +L I+R RDL LF+ + ++ Sbjct: 262 NFSIYFYHIYLHHQQGFSSIQKLASFLPQLIVQLALILRFS-RDLPFCLFLQTVAFVAFN 320 Query: 66 VIMNVYFLIYMVIILPISEKW 86 +M + ++ +LP+ W Sbjct: 321 KVMTAQYFVWFFCLLPLILPW 341 >02_01_0344 + 2467191-2468282 Length = 363 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 4/52 (7%) Query: 115 VKYINQTALDPVNIAKLIKESDGQNDEETVSRILKAFKEISKAYKIVEKTFR 166 ++YI Q L + L+ G N +E + + LKA +EI K K V K +R Sbjct: 236 LRYIKQDDLSSEDYKILM----GDNLDEVIDKRLKALEEIEKEKKRVAKAYR 283 >03_05_0944 + 29046793-29046922,29048091-29048464,29048556-29048687, 29048829-29049210,29049370-29049513,29049593-29049777, 29049925-29050051,29050603-29050676,29051071-29051147, 29051256-29051292,29051453-29051619,29051800-29051983, 29052053-29052130,29052451-29052570,29052648-29052707, 29053057-29053179,29053848-29053941,29054019-29054197, 29054737-29055039,29055373-29055474,29055553-29055693, 29055831-29055995,29056168-29056344,29056432-29056554, 29057787-29057867,29057983-29058099,29058214-29058386, 29058846-29058923,29058994-29059141,29059755-29059877, 29060015-29060071,29060145-29060255,29060382-29060573, 29060690-29060863,29061263-29061373,29061462-29061531, 29061734-29061812,29061898-29062000,29062086-29062256, 29062348-29062470,29062548-29062661,29062935-29063041, 29063117-29063168,29063245-29063351,29063589-29063703, 29063819-29063929,29064016-29064153,29064230-29064352, 29064535-29064606,29064774-29064886,29066780-29067110, 29067199-29067381,29068669-29068863,29068943-29069110, 29069208-29069340,29069511-29069595,29069726-29069765 Length = 2591 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Query: 116 KYINQTALDPVNIAKLIKESDGQNDEETVSR 146 K++N T L+ IAKL +ESDG + R Sbjct: 2560 KHLNMTGLEVRKIAKLPEESDGSESSDDDKR 2590 >02_01_0252 - 1657268-1657692,1657727-1658445,1658761-1659089, 1659223-1659375,1659430-1659561,1659748-1659852, 1660020-1660193,1660283-1660352,1660458-1660639, 1660738-1660847,1660948-1661052,1661153-1661231, 1662128-1662168,1662283-1662358,1662455-1662589 Length = 944 Score = 28.3 bits (60), Expect = 7.0 Identities = 22/100 (22%), Positives = 46/100 (46%), Gaps = 3/100 (3%) Query: 15 FIVFSNTFLHYEKNVQMFKSLCSIDELMKIVRLEHRDLKLFIAIILLLSSTVIMNVYFLI 74 F+++ L +E + L + K+ L+ + IA IL + +++N YFL+ Sbjct: 417 FLIWIQMILSFELPFALIPLLKFCNSSKKVGPLKESIYTVVIAWILSFA-LIVVNTYFLV 475 Query: 75 YMVIILPISEKWVPFAN--IGIMNEDLEAITFVSVLYMLY 112 + + + +AN I ++ L A V+V+Y+ + Sbjct: 476 WTYVDWLVHNNLPKYANGLISVVVFALMAAYLVAVVYLTF 515 >12_02_0226 + 15887835-15891188 Length = 1117 Score = 27.9 bits (59), Expect = 9.2 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 5/67 (7%) Query: 82 ISEKWVPFANIGIMNEDLEAITFVSVLYMLYDRVKYINQTALDPVNIAKLIKESDGQNDE 141 ISE W F NI NE+ + T + + + K L+ + + K + ESD + E Sbjct: 536 ISEAWDAFRNI---NENGQKPTLKAYTVFIQELCKA--SRPLEALKLLKEMLESDFRPSE 590 Query: 142 ETVSRIL 148 +T SRI+ Sbjct: 591 QTFSRII 597 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.329 0.142 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,386,560 Number of Sequences: 37544 Number of extensions: 231478 Number of successful extensions: 635 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 633 Number of HSP's gapped (non-prelim): 5 length of query: 272 length of database: 14,793,348 effective HSP length: 81 effective length of query: 191 effective length of database: 11,752,284 effective search space: 2244686244 effective search space used: 2244686244 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.8 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -