BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001066-TA|BGIBMGA001066-PA|IPR000215|Proteinase inhibitor I4, serpin (157 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 26 0.17 DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory pro... 21 3.7 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 25.8 bits (54), Expect = 0.17 Identities = 15/50 (30%), Positives = 25/50 (50%) Query: 50 IKPLRQLGVNQIFNETTSNFESILKSNSIIKNMFVNKVKQKLFLELDEMG 99 ++PLR L + N N SIL+ N +KN+ ++ K L+ + G Sbjct: 561 MQPLRTLKIGVYRNIKNFNIPSILQFNDGLKNLEIHVTKDTDTLDNEMRG 610 >DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory protein 10 protein. Length = 129 Score = 21.4 bits (43), Expect = 3.7 Identities = 8/16 (50%), Positives = 12/16 (75%) Query: 68 NFESILKSNSIIKNMF 83 + E ILKS+ ++KN F Sbjct: 32 DLEEILKSDRLLKNYF 47 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.322 0.139 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,425 Number of Sequences: 317 Number of extensions: 1262 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 157 length of database: 114,650 effective HSP length: 52 effective length of query: 105 effective length of database: 98,166 effective search space: 10307430 effective search space used: 10307430 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.4 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -