BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001063-TA|BGIBMGA001063-PA|IPR003511|DNA-binding HORMA, IPR011011|Zinc finger, FYVE/PHD-type (494 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 24 2.8 EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 pr... 22 8.5 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 22 8.5 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 8.5 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 23.8 bits (49), Expect = 2.8 Identities = 12/41 (29%), Positives = 20/41 (48%) Query: 54 TQAFEAFDKKYLHQLALCFYEGECKVENLIEYHIFEYSYNP 94 T+ E D+K + Q L F+ G V + + +E + NP Sbjct: 259 TKQVELTDEKIVAQALLFFFAGFETVSTGVSFMAYELATNP 299 >EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 protein. Length = 237 Score = 22.2 bits (45), Expect = 8.5 Identities = 10/38 (26%), Positives = 19/38 (50%) Query: 40 KCSDELAQFVSTALTQAFEAFDKKYLHQLALCFYEGEC 77 KC + +A+ + AF+A D K+L + + +C Sbjct: 43 KCDNNVAELKTCGNGLAFDASDPKFLTENCDYIHNVDC 80 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 22.2 bits (45), Expect = 8.5 Identities = 10/38 (26%), Positives = 19/38 (50%) Query: 40 KCSDELAQFVSTALTQAFEAFDKKYLHQLALCFYEGEC 77 KC + +A+ + AF+A D K+L + + +C Sbjct: 43 KCDNNVAELKTCGNGLAFDASDPKFLTENCDYIHNVDC 80 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 22.2 bits (45), Expect = 8.5 Identities = 9/34 (26%), Positives = 16/34 (47%) Query: 124 TIHLIRACVVIMQACQNELPSTYDVSLRLYYNDE 157 T+HL+R + P T +++ Y N+E Sbjct: 155 TVHLVRVGTEPRRVISFPFPETQFIAVTAYQNEE 188 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.131 0.376 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,505 Number of Sequences: 317 Number of extensions: 3924 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 4 length of query: 494 length of database: 114,650 effective HSP length: 59 effective length of query: 435 effective length of database: 95,947 effective search space: 41736945 effective search space used: 41736945 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -