BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001059-TA|BGIBMGA001059-PA|undefined (394 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 25 4.8 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 24 6.3 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 24.6 bits (51), Expect = 4.8 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 25 HTLRYRLPDLDTMAGLRRITLCGNTQLGDAGLTKLLEVLADDL 67 H +R+ +L A + G +GDAGL +++ +AD L Sbjct: 355 HAANFRM-ELSNSANASLVRAEGQEIVGDAGLARVITDMADVL 396 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 24.2 bits (50), Expect = 6.3 Identities = 12/49 (24%), Positives = 26/49 (53%) Query: 139 AVKDRGTITKNAPSKYLAKSSVVKKEKDYTEVLEEQLQEEISHRQQLEE 187 +V+DR N ++ +A +KK TE ++ +L E + ++ L++ Sbjct: 851 SVEDRKRQLTNCRNEVVATEKRIKKVLTDTEEVDRKLSEALKQQKTLQK 899 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.313 0.128 0.360 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 310,272 Number of Sequences: 2123 Number of extensions: 9891 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 15 Number of HSP's gapped (non-prelim): 3 length of query: 394 length of database: 516,269 effective HSP length: 65 effective length of query: 329 effective length of database: 378,274 effective search space: 124452146 effective search space used: 124452146 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -