BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001058-TA|BGIBMGA001058-PA|undefined (97 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 21 1.7 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 20 4.0 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 19 9.3 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 21.4 bits (43), Expect = 1.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Query: 61 SDPESEWNGRRSNSESDAEQPEADR 85 +D S W RR N+E+ +A R Sbjct: 133 NDDPSYWEKRRKNNEAAKRSRDARR 157 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 20.2 bits (40), Expect = 4.0 Identities = 10/38 (26%), Positives = 18/38 (47%) Query: 59 IFSDPESEWNGRRSNSESDAEQPEADRRPHGSAYLAYA 96 ++S + + SNS+ D + AD+ + S A A Sbjct: 78 LYSSEGQQNSNYSSNSKPDCSKGNADQNGYASVVAAAA 115 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 19.0 bits (37), Expect = 9.3 Identities = 8/34 (23%), Positives = 17/34 (50%) Query: 3 EIYDVTDADTDAVQSPTERDLNKQLEFDNDWSDE 36 E +++TD D + + L+K + W+D+ Sbjct: 7 EKFEITDYDLNNEFYRGRKKLSKHQQIYGIWADD 40 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.306 0.124 0.360 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,886 Number of Sequences: 317 Number of extensions: 616 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 97 length of database: 114,650 effective HSP length: 48 effective length of query: 49 effective length of database: 99,434 effective search space: 4872266 effective search space used: 4872266 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (19.3 bits) S2: 37 (19.0 bits)
- SilkBase 1999-2023 -