BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001058-TA|BGIBMGA001058-PA|undefined (97 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. 23 1.5 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 22 4.5 >DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. Length = 409 Score = 23.4 bits (48), Expect = 1.5 Identities = 10/31 (32%), Positives = 18/31 (58%) Query: 1 MTEIYDVTDADTDAVQSPTERDLNKQLEFDN 31 +T IY+ +D S T+R+L+ ++ DN Sbjct: 64 LTLIYEASDTSFGNAVSNTKRELSSVIQNDN 94 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/13 (53%), Positives = 9/13 (69%) Query: 66 EWNGRRSNSESDA 78 EW +R+NS DA Sbjct: 125 EWGSKRTNSRGDA 137 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.306 0.124 0.360 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,805 Number of Sequences: 2123 Number of extensions: 2655 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 97 length of database: 516,269 effective HSP length: 55 effective length of query: 42 effective length of database: 399,504 effective search space: 16779168 effective search space used: 16779168 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.5 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -