BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001057-TA|BGIBMGA001057-PA|undefined (58 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0004 - 12165074-12165334,12165405-12165489,12165584-12165957 26 3.4 09_03_0092 + 12306991-12307323,12308302-12308339,12308465-123092... 26 4.4 >12_02_0004 - 12165074-12165334,12165405-12165489,12165584-12165957 Length = 239 Score = 26.2 bits (55), Expect = 3.4 Identities = 11/22 (50%), Positives = 15/22 (68%) Query: 36 KLTTEAKRETNEGHLLERRTKK 57 ++TT AKRE N +L E R +K Sbjct: 18 EITTSAKREQNNSYLREWRARK 39 >09_03_0092 + 12306991-12307323,12308302-12308339,12308465-12309244, 12309386-12309875 Length = 546 Score = 25.8 bits (54), Expect = 4.4 Identities = 11/45 (24%), Positives = 22/45 (48%) Query: 8 LSLNLLQQLHGFVYTSHDRSEAAARIYYKLTTEAKRETNEGHLLE 52 + + ++ F+Y S+ R AR+ + +E ++ EG LE Sbjct: 457 IPFTICTSIYSFLYCSYPRDRERARMQSLIESELQQMEQEGSCLE 501 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.314 0.125 0.348 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,436,681 Number of Sequences: 37544 Number of extensions: 34236 Number of successful extensions: 86 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 84 Number of HSP's gapped (non-prelim): 2 length of query: 58 length of database: 14,793,348 effective HSP length: 38 effective length of query: 20 effective length of database: 13,366,676 effective search space: 267333520 effective search space used: 267333520 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -