BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001057-TA|BGIBMGA001057-PA|undefined (58 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-2377|AAS64833.1| 827|Drosophila melanogaster CG33455-P... 27 2.4 AY119114-1|AAM50974.1| 699|Drosophila melanogaster RE15216p pro... 27 4.1 AE014296-3763|AAS64918.1| 699|Drosophila melanogaster CG33217-P... 27 4.1 >AE013599-2377|AAS64833.1| 827|Drosophila melanogaster CG33455-PA protein. Length = 827 Score = 27.5 bits (58), Expect = 2.4 Identities = 15/55 (27%), Positives = 28/55 (50%) Query: 3 KSVWKLSLNLLQQLHGFVYTSHDRSEAAARIYYKLTTEAKRETNEGHLLERRTKK 57 ++V ++LN L + GF + HD + RI+ +L +++ +T L KK Sbjct: 520 RNVEPVNLNHLARSRGFTQSQHDMLQQQLRIHTQLLSQSYLQTYSHPTLYPMAKK 574 >AY119114-1|AAM50974.1| 699|Drosophila melanogaster RE15216p protein. Length = 699 Score = 26.6 bits (56), Expect = 4.1 Identities = 14/51 (27%), Positives = 24/51 (47%) Query: 7 KLSLNLLQQLHGFVYTSHDRSEAAARIYYKLTTEAKRETNEGHLLERRTKK 57 ++ + LL+ L + T H R+ + EA +TN+ LLE K+ Sbjct: 287 QMHIKLLELLEIVIKTCHTHLRMDFRLVLNILMEALEKTNKSMLLESNLKE 337 >AE014296-3763|AAS64918.1| 699|Drosophila melanogaster CG33217-PA protein. Length = 699 Score = 26.6 bits (56), Expect = 4.1 Identities = 14/51 (27%), Positives = 24/51 (47%) Query: 7 KLSLNLLQQLHGFVYTSHDRSEAAARIYYKLTTEAKRETNEGHLLERRTKK 57 ++ + LL+ L + T H R+ + EA +TN+ LLE K+ Sbjct: 287 QMHIKLLELLEIVIKTCHTHLRMDFRLVLNILMEALEKTNKSMLLESNLKE 337 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.314 0.125 0.348 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,434,037 Number of Sequences: 52641 Number of extensions: 61361 Number of successful extensions: 134 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 131 Number of HSP's gapped (non-prelim): 3 length of query: 58 length of database: 24,830,863 effective HSP length: 39 effective length of query: 19 effective length of database: 22,777,864 effective search space: 432779416 effective search space used: 432779416 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -