BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001054-TA|BGIBMGA001054-PA|IPR001394|Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 (392 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 24 1.6 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 5.0 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 24.2 bits (50), Expect = 1.6 Identities = 12/31 (38%), Positives = 17/31 (54%) Query: 59 DLFYSIATQKKKVGSIAPKKFIARLRKEKEE 89 D F + QK K A KK + +LR+E E+ Sbjct: 66 DYFIKMVKQKHKKDIRADKKALQKLRREVEK 96 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 5.0 Identities = 8/21 (38%), Positives = 12/21 (57%) Query: 340 IVKSHGFWLLFDDDMVDKIDA 360 I+K H W FD+ +K+ A Sbjct: 1868 IIKPHDTWADFDNKFYEKVTA 1888 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.135 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,443 Number of Sequences: 317 Number of extensions: 3868 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 3 length of query: 392 length of database: 114,650 effective HSP length: 58 effective length of query: 334 effective length of database: 96,264 effective search space: 32152176 effective search space used: 32152176 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -