BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001053-TA|BGIBMGA001053-PA|undefined (67 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F6.13c |||DUF726 family protein|Schizosaccharomyces pombe|c... 25 1.6 SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 22 8.7 >SPAC6F6.13c |||DUF726 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 778 Score = 24.6 bits (51), Expect = 1.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Query: 29 IMCLGAVLQQSRGVIARLEWKLMETHSLPDLGRVE 63 +M +G VL + +A+ E ++ET + D G +E Sbjct: 299 LMAVGEVLDINEFDVAKFEKHIVETIQIDDTGELE 333 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 22.2 bits (45), Expect = 8.7 Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 2 YVTSGHEKRSESAPSSRCE 20 ++ GHE++S S P CE Sbjct: 458 FLLKGHERKSCSDPIPTCE 476 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.129 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 294,742 Number of Sequences: 5004 Number of extensions: 7635 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 2 length of query: 67 length of database: 2,362,478 effective HSP length: 47 effective length of query: 20 effective length of database: 2,127,290 effective search space: 42545800 effective search space used: 42545800 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -