BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001053-TA|BGIBMGA001053-PA|undefined (67 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1426 + 27009720-27010787,27011846-27012517,27012999-270137... 27 1.4 07_03_0481 - 18572206-18574314,18574591-18575185,18575304-185753... 27 1.4 10_08_0829 - 20871810-20872011,20873226-20873359,20873480-208773... 26 3.3 02_05_0890 - 32546918-32547088,32547224-32547334,32547705-325478... 25 5.7 02_01_0319 - 2148788-2148892,2149474-2149557,2149643-2149723,215... 25 5.7 02_02_0166 - 7345920-7346137,7346549-7346687 25 10.0 >08_02_1426 + 27009720-27010787,27011846-27012517,27012999-27013793, 27014914-27014943,27018095-27019987 Length = 1485 Score = 27.5 bits (58), Expect = 1.4 Identities = 15/42 (35%), Positives = 21/42 (50%) Query: 10 RSESAPSSRCEPQLLVNHRIMCLGAVLQQSRGVIARLEWKLM 51 R S+PS +P V C V ++SR V+A E +LM Sbjct: 616 RESSSPSLNKDPNAAVKKLTRCTAMVPKRSRTVVAAEEAQLM 657 >07_03_0481 - 18572206-18574314,18574591-18575185,18575304-18575371, 18577344-18577458,18578179-18578333,18578673-18580621, 18580691-18581372,18581550-18581621,18582558-18583199, 18583301-18583402,18585011-18585100 Length = 2192 Score = 27.5 bits (58), Expect = 1.4 Identities = 17/67 (25%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Query: 1 MYVTSGHEKRSESAPSSRCEPQLLVNHRIMCLGAVLQQSRGVIARLEWKLMETHSLPDLG 60 + V GH ++ S+ L HR++ G LQ + G + L ++ S P L Sbjct: 744 LIVDEGHRLKNSSSKLFSLLNTLSFQHRVLLTGTPLQNNIGEMYNL-LNFLQPASFPSLA 802 Query: 61 RVETSWN 67 E +N Sbjct: 803 SFEEKFN 809 >10_08_0829 - 20871810-20872011,20873226-20873359,20873480-20877313, 20878057-20878177,20878414-20878451,20879096-20879218, 20879308-20879505,20880270-20880356 Length = 1578 Score = 26.2 bits (55), Expect = 3.3 Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 5 SGHEKRSESAPSSRCEPQLLVNHRIMCLGAVLQQSR 40 S E + S P RC+ ++ I CLGA + SR Sbjct: 115 SSLESTAISLPLKRCDSGTILQLNIQCLGAKSKTSR 150 >02_05_0890 - 32546918-32547088,32547224-32547334,32547705-32547884, 32547960-32548064,32548333-32548431,32548524-32548679, 32548772-32548850,32549213-32549278,32549382-32549536, 32549675-32550034,32550150-32550305,32550779-32550856, 32551471-32551812 Length = 685 Score = 25.4 bits (53), Expect = 5.7 Identities = 11/20 (55%), Positives = 14/20 (70%) Query: 7 HEKRSESAPSSRCEPQLLVN 26 HEKR+ S SR EP +LV+ Sbjct: 472 HEKRAWSVDFSRTEPSMLVS 491 >02_01_0319 - 2148788-2148892,2149474-2149557,2149643-2149723, 2150303-2150480,2150811-2150954,2151048-2151094, 2151353-2151409,2151566-2151664,2151867-2151989, 2152083-2152205,2152594-2152707,2152972-2153160, 2153412-2153578,2153904-2153988,2155431-2155628, 2155978-2156175 Length = 663 Score = 25.4 bits (53), Expect = 5.7 Identities = 9/26 (34%), Positives = 15/26 (57%) Query: 33 GAVLQQSRGVIARLEWKLMETHSLPD 58 GA+L+ + G + R W+L H P+ Sbjct: 11 GALLRSTNGFLGRAVWELDPDHGTPE 36 >02_02_0166 - 7345920-7346137,7346549-7346687 Length = 118 Score = 24.6 bits (51), Expect = 10.0 Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 33 GAVLQQSRGVIARLEWKLMETHSLPDLGRVETS 65 G+ L+ SRGV + W+ E H GR+ S Sbjct: 81 GSTLENSRGVGSEEAWRDSEGHDRCPAGRLPRS 113 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.129 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,013,303 Number of Sequences: 37544 Number of extensions: 58825 Number of successful extensions: 102 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 97 Number of HSP's gapped (non-prelim): 6 length of query: 67 length of database: 14,793,348 effective HSP length: 47 effective length of query: 20 effective length of database: 13,028,780 effective search space: 260575600 effective search space used: 260575600 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -