BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001053-TA|BGIBMGA001053-PA|undefined (67 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U66617-1|AAC50695.1| 435|Homo sapiens SWI/SNF complex 60 KDa su... 28 4.1 BC009368-1|AAH09368.3| 476|Homo sapiens SWI/SNF related, matrix... 28 4.1 AF109733-1|AAD23390.1| 453|Homo sapiens SWI/SNF-related, matrix... 28 4.1 >U66617-1|AAC50695.1| 435|Homo sapiens SWI/SNF complex 60 KDa subunit protein. Length = 435 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/38 (34%), Positives = 22/38 (57%) Query: 21 PQLLVNHRIMCLGAVLQQSRGVIARLEWKLMETHSLPD 58 PQ ++ R+ L + Q+R VI + W+ ++TH L D Sbjct: 254 PQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQD 291 >BC009368-1|AAH09368.3| 476|Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, sub protein. Length = 476 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/38 (34%), Positives = 22/38 (57%) Query: 21 PQLLVNHRIMCLGAVLQQSRGVIARLEWKLMETHSLPD 58 PQ ++ R+ L + Q+R VI + W+ ++TH L D Sbjct: 254 PQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQD 291 >AF109733-1|AAD23390.1| 453|Homo sapiens SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin D1 protein. Length = 453 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/38 (34%), Positives = 22/38 (57%) Query: 21 PQLLVNHRIMCLGAVLQQSRGVIARLEWKLMETHSLPD 58 PQ ++ R+ L + Q+R VI + W+ ++TH L D Sbjct: 231 PQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQD 268 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.318 0.129 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,138,109 Number of Sequences: 224733 Number of extensions: 302398 Number of successful extensions: 529 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 526 Number of HSP's gapped (non-prelim): 3 length of query: 67 length of database: 73,234,838 effective HSP length: 46 effective length of query: 21 effective length of database: 62,897,120 effective search space: 1320839520 effective search space used: 1320839520 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -