BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001051-TA|BGIBMGA001051-PA|IPR004045|Glutathione S-transferase, N-terminal, IPR012336|Thioredoxin-like fold (68 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20358| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 6.5 SB_30755| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 6.5 >SB_20358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1323 Score = 25.4 bits (53), Expect = 6.5 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Query: 19 MVIEALNIPNVKYVDVDLLAEDHLKEEFLKLNPQHTIPMLTDDKFVI 65 ++ E LN+ + VD L ED ++E+ N +H +L DD +V+ Sbjct: 1253 LLAELLNLVQKRSFIVDSLEEDRIREKQEDENIKH---VLEDDGYVV 1296 >SB_30755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 906 Score = 25.4 bits (53), Expect = 6.5 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 5/62 (8%) Query: 2 VLTLYKMD--ASPPVRAVYMVIEALNIPNVKYVDVDLLAEDHLKEEFLKLNPQHTIPMLT 59 +L YK + S P V++ +N+P+V V L ED ++ L L + M T Sbjct: 218 ILEKYKEENLISNPESIVFLPHVNVNVPSVS---VGSLGEDKFLDDALPLPNSSPVAMAT 274 Query: 60 DD 61 DD Sbjct: 275 DD 276 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.323 0.140 0.417 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,252,263 Number of Sequences: 59808 Number of extensions: 67699 Number of successful extensions: 162 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 162 Number of HSP's gapped (non-prelim): 2 length of query: 68 length of database: 16,821,457 effective HSP length: 47 effective length of query: 21 effective length of database: 14,010,481 effective search space: 294220101 effective search space used: 294220101 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -