BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001050-TA|BGIBMGA001050-PA|undefined (94 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 21 2.5 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 21 2.5 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 3.4 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 3.4 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 3.4 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.0 bits (42), Expect = 2.5 Identities = 13/49 (26%), Positives = 19/49 (38%) Query: 14 ICAVEGVYPKPELNILVGNRLLIDTKSSINLIDGRYTALTTAVVNVNSL 62 +C + Y + L D K LID + + V NVNS+ Sbjct: 462 VCHADDAYMVVDTPFLASTTTTNDIKMQKVLIDFWVSFVNNGVPNVNSV 510 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.0 bits (42), Expect = 2.5 Identities = 13/49 (26%), Positives = 19/49 (38%) Query: 14 ICAVEGVYPKPELNILVGNRLLIDTKSSINLIDGRYTALTTAVVNVNSL 62 +C + Y + L D K LID + + V NVNS+ Sbjct: 462 VCHADDAYMVVDTPFLASTTTTNDIKMQKVLIDFWVSFVNNGVPNVNSV 510 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.6 bits (41), Expect = 3.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 63 PTTVELLCEMQVPLANYYSKKRDLFY 88 PT +E L + + YSK+ DL + Sbjct: 644 PTVLEELTHGTLAASTLYSKRPDLLH 669 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.6 bits (41), Expect = 3.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 63 PTTVELLCEMQVPLANYYSKKRDLFY 88 PT +E L + + YSK+ DL + Sbjct: 644 PTVLEELTHGTLAASTLYSKRPDLLH 669 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.6 bits (41), Expect = 3.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 63 PTTVELLCEMQVPLANYYSKKRDLFY 88 PT +E L + + YSK+ DL + Sbjct: 644 PTVLEELTHGTLAASTLYSKRPDLLH 669 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.322 0.139 0.419 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,147 Number of Sequences: 429 Number of extensions: 1118 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 94 length of database: 140,377 effective HSP length: 49 effective length of query: 45 effective length of database: 119,356 effective search space: 5371020 effective search space used: 5371020 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.5 bits) S2: 38 (19.4 bits)
- SilkBase 1999-2023 -