BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001049-TA|BGIBMGA001049-PA|undefined (89 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 21 2.6 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 20.6 bits (41), Expect = 2.6 Identities = 11/30 (36%), Positives = 15/30 (50%) Query: 18 TARLVPKDLNFLQNLNRIKVAEDILAWVNF 47 T L+P +N L K+A + WVNF Sbjct: 136 TVYLLPIIINPLVLYEARKLANVVTDWVNF 165 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.137 0.425 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,653 Number of Sequences: 317 Number of extensions: 789 Number of successful extensions: 1 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of query: 89 length of database: 114,650 effective HSP length: 47 effective length of query: 42 effective length of database: 99,751 effective search space: 4189542 effective search space used: 4189542 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (20.0 bits) S2: 37 (19.0 bits)
- SilkBase 1999-2023 -