GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001049-TA|BGIBMGA001049-PA|undefined
         (89 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory recept...    21   2.6  

>AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory receptor
           candidate 38 protein.
          Length = 436

 Score = 20.6 bits (41), Expect = 2.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)

Query: 18  TARLVPKDLNFLQNLNRIKVAEDILAWVNF 47
           T  L+P  +N L      K+A  +  WVNF
Sbjct: 136 TVYLLPIIINPLVLYEARKLANVVTDWVNF 165


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.321    0.137    0.425 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,653
Number of Sequences: 317
Number of extensions: 789
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 89
length of database: 114,650
effective HSP length: 47
effective length of query: 42
effective length of database: 99,751
effective search space:  4189542
effective search space used:  4189542
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 37 (20.0 bits)
S2: 37 (19.0 bits)