BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001049-TA|BGIBMGA001049-PA|undefined (89 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0681 + 20659789-20659839,20660030-20660170,20661294-206613... 28 1.1 05_07_0316 + 29191558-29192008,29192764-29192831 27 1.4 11_03_0193 - 11437237-11437533,11438834-11439643 27 1.8 10_08_0672 + 19762340-19762432,19762543-19762735,19763225-197632... 27 1.8 07_03_0630 - 20097672-20097772,20097983-20102012 27 1.8 10_05_0095 + 9140375-9140676,9140895-9141123,9141444-9141488 27 2.4 12_02_1081 + 25914180-25914371,25918121-25919104 25 5.6 08_02_1073 - 24117834-24118037,24118122-24118211,24118299-241184... 25 5.6 11_05_0007 - 18324969-18325063,18326580-18326745,18327078-183272... 25 7.5 03_02_0277 + 7056341-7056391,7056681-7056764,7057107-7057223,705... 25 7.5 11_05_0010 - 18356835-18357080,18357475-18357672,18357780-183580... 25 9.9 08_02_1422 - 26971803-26971900,26974083-26975061 25 9.9 06_03_0593 + 22596372-22596384,22596856-22597037,22597119-225973... 25 9.9 01_06_1143 - 34862005-34862370,34862494-34862628,34862742-348629... 25 9.9 >07_03_0681 + 20659789-20659839,20660030-20660170,20661294-20661399, 20661625-20661806,20661888-20662113,20662198-20662624, 20662844-20663189,20663271-20663849 Length = 685 Score = 27.9 bits (59), Expect = 1.1 Identities = 12/25 (48%), Positives = 14/25 (56%) Query: 8 RGCLYHIKHVTARLVPKDLNFLQNL 32 RGC YH+K R P+D L NL Sbjct: 256 RGCRYHLKEYDRRNYPRDSRELFNL 280 >05_07_0316 + 29191558-29192008,29192764-29192831 Length = 172 Score = 27.5 bits (58), Expect = 1.4 Identities = 13/36 (36%), Positives = 20/36 (55%) Query: 10 CLYHIKHVTARLVPKDLNFLQNLNRIKVAEDILAWV 45 C + VT RL+ DL ++ + R K AE + AW+ Sbjct: 104 CCLCVYIVTMRLISVDLPYVYRVCRGKDAEAVAAWI 139 >11_03_0193 - 11437237-11437533,11438834-11439643 Length = 368 Score = 27.1 bits (57), Expect = 1.8 Identities = 23/64 (35%), Positives = 31/64 (48%), Gaps = 8/64 (12%) Query: 17 VTA-RLVPKDLNFLQNLNRIKV------AEDILAWVNFNGTLMKCI-VAGDETGDDVVDM 68 VTA L P L FL+ L R+ V A+D + T + C+ V GD+ G +VD Sbjct: 61 VTALSLPPSKLPFLRRLMRLLVHSGVFAADDTTDTGTYRLTPLSCLLVDGDDDGAAIVDG 120 Query: 69 HTGQ 72 H Q Sbjct: 121 HPSQ 124 >10_08_0672 + 19762340-19762432,19762543-19762735,19763225-19763269, 19763381-19763432,19763601-19763704,19763887-19763987, 19764225-19764283,19764536-19764592,19764944-19764989, 19765187-19765266,19766841-19767096,19767210-19767405, 19768368-19768448,19768536-19768587,19768759-19768862, 19769586-19769686,19769924-19769982,19770491-19770536, 19770789-19770868,19770953-19771013 Length = 621 Score = 27.1 bits (57), Expect = 1.8 Identities = 12/60 (20%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Query: 24 KDLNFLQNLNRIKVAEDILAWVN--FNGTLMKCIVAGDETGDDVVDMHTGQQVLERCLST 81 +D++ ++ + + + + W N F TL + + G E +HT ++ +CL + Sbjct: 209 EDVHHIEGALIVNIGDLLQRWTNCVFRSTLHRVVAVGKERYSVAFFLHTNPDLVVQCLES 268 >07_03_0630 - 20097672-20097772,20097983-20102012 Length = 1376 Score = 27.1 bits (57), Expect = 1.8 Identities = 12/32 (37%), Positives = 18/32 (56%) Query: 22 VPKDLNFLQNLNRIKVAEDILAWVNFNGTLMK 53 +P D+NFL NL + + +A +N G L K Sbjct: 711 LPGDMNFLINLRHLHASSGTIAQINGIGKLTK 742 >10_05_0095 + 9140375-9140676,9140895-9141123,9141444-9141488 Length = 191 Score = 26.6 bits (56), Expect = 2.4 Identities = 12/32 (37%), Positives = 18/32 (56%) Query: 41 ILAWVNFNGTLMKCIVAGDETGDDVVDMHTGQ 72 IL W FNG+ ++ + ETG+ + TGQ Sbjct: 108 ILKWYRFNGSKLQVMGTTPETGEWAIVGGTGQ 139 >12_02_1081 + 25914180-25914371,25918121-25919104 Length = 391 Score = 25.4 bits (53), Expect = 5.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Query: 22 VPKDLNFLQNLNRIKVA 38 +PK L+FL+N+NR A Sbjct: 154 IPKSLSFLENINRFAFA 170 >08_02_1073 - 24117834-24118037,24118122-24118211,24118299-24118404, 24118477-24118648,24118737-24118839,24118927-24119181, 24119259-24119336,24119449-24119541,24119660-24119800, 24119882-24119986,24120135-24120212,24120297-24120341, 24120463-24120579,24120685-24120828,24120934-24121017, 24121139-24121232,24121322-24121447,24121585-24121658, 24121870-24122098,24123124-24123611,24123702-24123749, 24123841-24124077,24124368-24124404,24125011-24125018 Length = 1051 Score = 25.4 bits (53), Expect = 5.6 Identities = 11/25 (44%), Positives = 15/25 (60%) Query: 61 TGDDVVDMHTGQQVLERCLSTEEKL 85 T DD+VD G+Q+ E C + E L Sbjct: 112 TNDDIVDCSHGKQLWELCQNKYEPL 136 >11_05_0007 - 18324969-18325063,18326580-18326745,18327078-18327275, 18327377-18327643,18328070-18328129,18328767-18329033, 18329156-18329359,18329441-18331496,18332517-18333358 Length = 1384 Score = 25.0 bits (52), Expect = 7.5 Identities = 11/63 (17%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Query: 21 LVPKDLNFLQNLNRIKVAEDILAWVNFNGTLMKCIVAGDETGDDVVDMHTGQQVLERCLS 80 ++ K + L+++ + +DI W L+KC++ ++ G ++ V + C Sbjct: 269 IIDKIRDILKDIRYFIIIDDI--WDKPTWQLLKCVLIDNDHGSKIITTTRNMDVAKLCCY 326 Query: 81 TEE 83 +++ Sbjct: 327 SDD 329 >03_02_0277 + 7056341-7056391,7056681-7056764,7057107-7057223, 7057335-7057772,7057889-7058295,7058371-7058470, 7058707-7058793,7059056-7059544 Length = 590 Score = 25.0 bits (52), Expect = 7.5 Identities = 10/42 (23%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Query: 31 NLNRIKVAEDILAWVNFNGTLM---KCIVAGDETGDDVVDMH 69 +LN +K E I W+N + +M +++G ++++ H Sbjct: 376 DLNGMKNEEKIAFWINVHNAMMMHLSYLISGQRVNPELIEYH 417 >11_05_0010 - 18356835-18357080,18357475-18357672,18357780-18358046, 18358870-18359067,18359151-18359417,18359524-18359724, 18359807-18361363,18361499-18361859,18362602-18363467 Length = 1386 Score = 24.6 bits (51), Expect = 9.9 Identities = 11/63 (17%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Query: 21 LVPKDLNFLQNLNRIKVAEDILAWVNFNGTLMKCIVAGDETGDDVVDMHTGQQVLERCLS 80 ++ K + L+++ + +DI W L+KC++ ++ G ++ V + C Sbjct: 277 IIDKIRDVLKDIRYFIIIDDI--WDKPTWQLLKCVLIDNDHGSKIITTTRNMDVAKLCCY 334 Query: 81 TEE 83 +++ Sbjct: 335 SDD 337 >08_02_1422 - 26971803-26971900,26974083-26975061 Length = 358 Score = 24.6 bits (51), Expect = 9.9 Identities = 10/28 (35%), Positives = 16/28 (57%) Query: 35 IKVAEDILAWVNFNGTLMKCIVAGDETG 62 I +AE +L WV+ + +M C + D G Sbjct: 203 ITIAEGVLGWVDLDHGVMVCDLREDVPG 230 >06_03_0593 + 22596372-22596384,22596856-22597037,22597119-22597344, 22597429-22597855,22598075-22598429,22598511-22599089 Length = 593 Score = 24.6 bits (51), Expect = 9.9 Identities = 11/24 (45%), Positives = 12/24 (50%) Query: 9 GCLYHIKHVTARLVPKDLNFLQNL 32 GC YH+K R P D L NL Sbjct: 162 GCRYHLKEYDRRNYPHDSRELFNL 185 >01_06_1143 - 34862005-34862370,34862494-34862628,34862742-34862992, 34863192-34863243,34863408-34863694,34864030-34864182, 34865393-34865889,34866173-34866241,34867006-34867074, 34867486-34867560,34869341-34869412,34869499-34869570, 34869664-34869807,34870321-34870416,34870736-34870807, 34871081-34871152,34871683-34871830,34872609-34872708 Length = 909 Score = 24.6 bits (51), Expect = 9.9 Identities = 7/19 (36%), Positives = 16/19 (84%) Query: 22 VPKDLNFLQNLNRIKVAED 40 +P ++ +LQNLNR+++ ++ Sbjct: 174 LPDEIGYLQNLNRLQIDQN 192 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.321 0.137 0.425 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,744,089 Number of Sequences: 37544 Number of extensions: 94592 Number of successful extensions: 182 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 173 Number of HSP's gapped (non-prelim): 14 length of query: 89 length of database: 14,793,348 effective HSP length: 68 effective length of query: 21 effective length of database: 12,240,356 effective search space: 257047476 effective search space used: 257047476 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -