BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001047-TA|BGIBMGA001047-PA|undefined (103 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 24 0.37 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 3.4 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 20 6.0 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 20 6.0 AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esteras... 19 7.9 AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esteras... 19 7.9 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 23.8 bits (49), Expect = 0.37 Identities = 10/34 (29%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 35 IMEWIMKLPVSLFK-SIRIGSFIVNLFGFVKMRY 67 + +++M+ V F+ S+R F+ +FG V ++Y Sbjct: 360 LKQYVMQQQVKNFRHSVRSVFFLSEIFGLVNLKY 393 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 20.6 bits (41), Expect = 3.4 Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 44 VSLFKSIRIGSFIVNLFGFV 63 +++ KS+R +IV+L G V Sbjct: 501 INIMKSVRQHPYIVSLIGCV 520 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 19.8 bits (39), Expect = 6.0 Identities = 7/10 (70%), Positives = 9/10 (90%) Query: 54 SFIVNLFGFV 63 SF+VN FGF+ Sbjct: 488 SFLVNDFGFI 497 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 19.8 bits (39), Expect = 6.0 Identities = 9/34 (26%), Positives = 20/34 (58%) Query: 48 KSIRIGSFIVNLFGFVKMRYLFVIALNNIGLRDF 81 KS R+ I NL+ + + + + ++++G+R F Sbjct: 111 KSFRMNFAIFNLYMVLLLLFDAYLWISSVGVRMF 144 >AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 19.4 bits (38), Expect = 7.9 Identities = 8/30 (26%), Positives = 16/30 (53%) Query: 54 SFIVNLFGFVKMRYLFVIALNNIGLRDFVL 83 ++ + + GF+ + + N GL+D VL Sbjct: 138 NYRIGIIGFLSLEDPDLEVPGNAGLKDMVL 167 >AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esterase protein. Length = 510 Score = 19.4 bits (38), Expect = 7.9 Identities = 8/30 (26%), Positives = 16/30 (53%) Query: 54 SFIVNLFGFVKMRYLFVIALNNIGLRDFVL 83 ++ + + GF+ + + N GL+D VL Sbjct: 138 NYRIGIIGFLSLEDPDLEVPGNAGLKDMVL 167 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.338 0.150 0.489 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,778 Number of Sequences: 317 Number of extensions: 927 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 103 length of database: 114,650 effective HSP length: 48 effective length of query: 55 effective length of database: 99,434 effective search space: 5468870 effective search space used: 5468870 T: 11 A: 40 X1: 15 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (21.3 bits) S2: 38 (19.4 bits)
- SilkBase 1999-2023 -