BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001047-TA|BGIBMGA001047-PA|undefined (103 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pomb... 27 0.45 SPAP7G5.03 |||conjugation protein |Schizosaccharomyces pombe|chr... 26 1.4 SPAC22A12.07c |ogm1|oma1|protein O-mannosyltransferase Ogm1|Schi... 24 5.5 SPAC3F10.02c |trk1|sptrk|potassium ion transporter Trk1|Schizosa... 23 7.3 >SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pombe|chr 2|||Manual Length = 2386 Score = 27.5 bits (58), Expect = 0.45 Identities = 12/42 (28%), Positives = 21/42 (50%) Query: 29 VKHKACIMEWIMKLPVSLFKSIRIGSFIVNLFGFVKMRYLFV 70 +K +++WI+ +SLF IR +L F K+ Y + Sbjct: 105 IKSSVTLLDWILPRTISLFADIRFIKLFDSLKEFHKLIYQLI 146 >SPAP7G5.03 |||conjugation protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 703 Score = 25.8 bits (54), Expect = 1.4 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 8/89 (8%) Query: 2 LLDPLMFVRLFGD-RWRYSYRRRNITWPVKHKACIMEWIMKLPVSLFKSIRIGSFIVNLF 60 LLD + F D R SY I+W +K+ +I LP+ F S+++ FI +F Sbjct: 318 LLDEHIRSNKFEDTRDLISYIESPISWNLKY------FISALPLPCFLSVQLRWFITYIF 371 Query: 61 GFVKMRYLFVIALNNI-GLRDFVLIRILR 88 LF+ + I G+ VL+ +R Sbjct: 372 HPPAAMILFISCTSFISGILQLVLLNNIR 400 >SPAC22A12.07c |ogm1|oma1|protein O-mannosyltransferase Ogm1|Schizosaccharomyces pombe|chr 1|||Manual Length = 893 Score = 23.8 bits (49), Expect = 5.5 Identities = 14/62 (22%), Positives = 26/62 (41%) Query: 20 YRRRNITWPVKHKACIMEWIMKLPVSLFKSIRIGSFIVNLFGFVKMRYLFVIALNNIGLR 79 Y +TWP+ + L V + + +++L F + +F +A N+G Sbjct: 542 YESSALTWPLLLGPLRFFYEQHLQVFFMGNPFVWYSVISLVAFFVIVQIFCLARWNLGYN 601 Query: 80 DF 81 DF Sbjct: 602 DF 603 >SPAC3F10.02c |trk1|sptrk|potassium ion transporter Trk1|Schizosaccharomyces pombe|chr 1|||Manual Length = 841 Score = 23.4 bits (48), Expect = 7.3 Identities = 7/22 (31%), Positives = 16/22 (72%) Query: 55 FIVNLFGFVKMRYLFVIALNNI 76 +++ FGF+ + Y+++I+L I Sbjct: 12 WVIPTFGFLAIHYIYIISLTII 33 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.338 0.150 0.489 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 464,276 Number of Sequences: 5004 Number of extensions: 16658 Number of successful extensions: 49 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 47 Number of HSP's gapped (non-prelim): 4 length of query: 103 length of database: 2,362,478 effective HSP length: 63 effective length of query: 40 effective length of database: 2,047,226 effective search space: 81889040 effective search space used: 81889040 T: 11 A: 40 X1: 15 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (21.8 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -