BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001047-TA|BGIBMGA001047-PA|undefined (103 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC111702-1|AAI11703.2| 707|Homo sapiens interleukin 17 receptor... 27 7.6 AY489047-1|AAS15051.2| 707|Homo sapiens SEF splice variant b pr... 27 7.6 AY358774-1|AAQ89134.1| 728|Homo sapiens IL17Rhom protein. 27 7.6 AL133097-1|CAB61408.1| 564|Homo sapiens hypothetical protein pr... 27 7.6 AF494211-1|AAM74080.1| 595|Homo sapiens interleukin 17 receptor... 27 7.6 AF494208-1|AAM74077.1| 739|Homo sapiens interleukin 17 receptor... 27 7.6 AF458067-1|AAM77571.1| 739|Homo sapiens IL-17RD protein. 27 7.6 >BC111702-1|AAI11703.2| 707|Homo sapiens interleukin 17 receptor D protein. Length = 707 Score = 27.5 bits (58), Expect = 7.6 Identities = 13/48 (27%), Positives = 23/48 (47%) Query: 12 FGDRWRYSYRRRNITWPVKHKACIMEWIMKLPVSLFKSIRIGSFIVNL 59 FG R+ Y + + P K K C E ++ L +++ G +I+ L Sbjct: 193 FGFRFFYLHYKLKHEGPFKRKTCKQEQTTEMTSCLLQNVSPGDYIIEL 240 >AY489047-1|AAS15051.2| 707|Homo sapiens SEF splice variant b protein. Length = 707 Score = 27.5 bits (58), Expect = 7.6 Identities = 13/48 (27%), Positives = 23/48 (47%) Query: 12 FGDRWRYSYRRRNITWPVKHKACIMEWIMKLPVSLFKSIRIGSFIVNL 59 FG R+ Y + + P K K C E ++ L +++ G +I+ L Sbjct: 193 FGFRFFYLHYKLKHEGPFKRKTCKQEQTTEMTSCLLQNVSPGDYIIEL 240 >AY358774-1|AAQ89134.1| 728|Homo sapiens IL17Rhom protein. Length = 728 Score = 27.5 bits (58), Expect = 7.6 Identities = 13/48 (27%), Positives = 23/48 (47%) Query: 12 FGDRWRYSYRRRNITWPVKHKACIMEWIMKLPVSLFKSIRIGSFIVNL 59 FG R+ Y + + P K K C E ++ L +++ G +I+ L Sbjct: 214 FGFRFFYLHYKLKHEGPFKRKTCKQEQTTEMTSCLLQNVSPGDYIIEL 261 >AL133097-1|CAB61408.1| 564|Homo sapiens hypothetical protein protein. Length = 564 Score = 27.5 bits (58), Expect = 7.6 Identities = 13/48 (27%), Positives = 23/48 (47%) Query: 12 FGDRWRYSYRRRNITWPVKHKACIMEWIMKLPVSLFKSIRIGSFIVNL 59 FG R+ Y + + P K K C E ++ L +++ G +I+ L Sbjct: 50 FGFRFFYLHYKLKHEGPFKRKTCKQEQTTEMTSCLLQNVSPGDYIIEL 97 >AF494211-1|AAM74080.1| 595|Homo sapiens interleukin 17 receptor-like protein short form protein. Length = 595 Score = 27.5 bits (58), Expect = 7.6 Identities = 13/48 (27%), Positives = 23/48 (47%) Query: 12 FGDRWRYSYRRRNITWPVKHKACIMEWIMKLPVSLFKSIRIGSFIVNL 59 FG R+ Y + + P K K C E ++ L +++ G +I+ L Sbjct: 81 FGFRFFYLHYKLKHEGPFKRKTCKQEQTTEMTSCLLQNVSPGDYIIEL 128 >AF494208-1|AAM74077.1| 739|Homo sapiens interleukin 17 receptor-like protein long form protein. Length = 739 Score = 27.5 bits (58), Expect = 7.6 Identities = 13/48 (27%), Positives = 23/48 (47%) Query: 12 FGDRWRYSYRRRNITWPVKHKACIMEWIMKLPVSLFKSIRIGSFIVNL 59 FG R+ Y + + P K K C E ++ L +++ G +I+ L Sbjct: 225 FGFRFFYLHYKLKHEGPFKRKTCEQEQTTEMTSCLLQNVSPGDYIIEL 272 >AF458067-1|AAM77571.1| 739|Homo sapiens IL-17RD protein. Length = 739 Score = 27.5 bits (58), Expect = 7.6 Identities = 13/48 (27%), Positives = 23/48 (47%) Query: 12 FGDRWRYSYRRRNITWPVKHKACIMEWIMKLPVSLFKSIRIGSFIVNL 59 FG R+ Y + + P K K C E ++ L +++ G +I+ L Sbjct: 225 FGFRFFYLHYKLKHEGPFKRKTCKQEQTTEMTSCLLQNVSPGDYIIEL 272 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.338 0.150 0.489 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,237,169 Number of Sequences: 224733 Number of extensions: 484761 Number of successful extensions: 6873 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6866 Number of HSP's gapped (non-prelim): 7 length of query: 103 length of database: 73,234,838 effective HSP length: 78 effective length of query: 25 effective length of database: 55,705,664 effective search space: 1392641600 effective search space used: 1392641600 T: 11 A: 40 X1: 15 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (21.8 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -