BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001046-TA|BGIBMGA001046-PA|undefined (90 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 1.5 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 2.7 AM295016-1|CAL25731.1| 96|Tribolium castaneum ecdysone recepto... 20 3.5 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 19 6.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 19 8.2 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 19 8.2 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.4 bits (43), Expect = 1.5 Identities = 7/23 (30%), Positives = 14/23 (60%) Query: 31 VETTGVWSSEAKKFIAAIGHRLR 53 ++ TGVW + ++ +G +LR Sbjct: 757 IKITGVWLKFLRVILSVVGVKLR 779 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 20.6 bits (41), Expect = 2.7 Identities = 12/38 (31%), Positives = 17/38 (44%) Query: 49 GHRLRRHDPGLVQRLSIAIQRGNAASVMGTFGPGAIQS 86 G L H P L Q+ +A + + G GPG +S Sbjct: 300 GGPLHDHRPALAQQRRVAAVQVPQLAGGGRRGPGPARS 337 >AM295016-1|CAL25731.1| 96|Tribolium castaneum ecdysone receptor (isoform B) protein. Length = 96 Score = 20.2 bits (40), Expect = 3.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Query: 10 NVNASYKPQIAAIKQNAYGMAVET 33 ++NA P+ I QN YG+ T Sbjct: 48 DLNAQNHPRGLTIIQNGYGLPGHT 71 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 19.4 bits (38), Expect = 6.2 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Query: 49 GHRLRRHDPGLVQRLSIAIQRGNAASVMG--TFGPGAIQ 85 G R R PG+V R ++A+ MG +G A Q Sbjct: 39 GGRRRAARPGVVTTPRWGCARASSATTMGGPRYGRAAAQ 77 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 19.0 bits (37), Expect = 8.2 Identities = 7/18 (38%), Positives = 12/18 (66%) Query: 39 SEAKKFIAAIGHRLRRHD 56 S ++F+ A+ LRRH+ Sbjct: 731 SARRRFVVAVVGFLRRHN 748 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 19.0 bits (37), Expect = 8.2 Identities = 8/28 (28%), Positives = 13/28 (46%) Query: 47 AIGHRLRRHDPGLVQRLSIAIQRGNAAS 74 A+ H L RHD +++ + A S Sbjct: 133 AMPHNLTRHDGSVIKNQGMPTMEAIARS 160 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.132 0.383 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,973 Number of Sequences: 317 Number of extensions: 636 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 90 length of database: 114,650 effective HSP length: 47 effective length of query: 43 effective length of database: 99,751 effective search space: 4289293 effective search space used: 4289293 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (19.8 bits) S2: 37 (19.0 bits)
- SilkBase 1999-2023 -