BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001043-TA|BGIBMGA001043-PA|IPR001196|Ribosomal protein L15 (138 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 2.1 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 2.7 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 22.2 bits (45), Expect = 2.1 Identities = 11/41 (26%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Query: 24 NAGGEHHHRINMDKYHPGYFGK-LGMRNFHFRKNKNFCPVL 63 N G + + N+ + YF + +G+ +F+F N N+ P + Sbjct: 203 NYTGWYLTKHNVPEQRLNYFTEDVGLNHFYFMLNHNYPPFM 243 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.8 bits (44), Expect = 2.7 Identities = 10/20 (50%), Positives = 11/20 (55%) Query: 72 VSEQTRLKYASAPDGKVPVI 91 V EQT A D KVP+I Sbjct: 230 VKEQTLQSIEMAKDAKVPII 249 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.321 0.140 0.448 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,314 Number of Sequences: 429 Number of extensions: 1439 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 138 length of database: 140,377 effective HSP length: 52 effective length of query: 86 effective length of database: 118,069 effective search space: 10153934 effective search space used: 10153934 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.4 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -