SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001041-TA|BGIBMGA001041-PA|IPR000873|AMP-dependent
synthetase and ligase, IPR002372|Pyrrolo-quinoline quinone,
IPR011047|Quinonprotein alcohol dehydrogenase-like, IPR009081|Acyl
carrier protein-like, IPR006163|Phosphopantetheine-binding
         (758 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ292755-1|CAC00630.1|  837|Anopheles gambiae integrin beta subu...    25   7.4  

>AJ292755-1|CAC00630.1|  837|Anopheles gambiae integrin beta subunit
           protein.
          Length = 837

 Score = 25.0 bits (52), Expect = 7.4
 Identities = 12/50 (24%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 8   CTNGASLLIAPDLTEVLFHED-NDNSVTFWQTTPSKFFQHSNENIKNKIL 56
           C    +L +   + +V   E+ NDN  TF+     +F    N++ ++K++
Sbjct: 704 CATNCTLFVPIPVEKVTIDEERNDNKCTFFDEDDCRFEFSYNDSDQDKVV 753


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.320    0.135    0.409 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 799,361
Number of Sequences: 2123
Number of extensions: 33428
Number of successful extensions: 61
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 61
Number of HSP's gapped (non-prelim): 1
length of query: 758
length of database: 516,269
effective HSP length: 69
effective length of query: 689
effective length of database: 369,782
effective search space: 254779798
effective search space used: 254779798
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 51 (24.6 bits)

- SilkBase 1999-2023 -