Silkworm BLAST Result against arabidopsis

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001040-TA|BGIBMGA001040-PA|undefined
         (188 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g17610.1 68417.m02633 tRNA/rRNA methyltransferase (SpoU) fami...    27   7.9  

>At4g17610.1 68417.m02633 tRNA/rRNA methyltransferase (SpoU) family
            protein similar to TAR RNA loop binding protein [Homo
            sapiens] GI:1184692; contains Pfam profile PF00588: SpoU
            rRNA Methylase (RNA methyltransferase, TrmH) family
          Length = 1850

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 3/54 (5%)

Query: 81   LNASMAQAMMLDAIDPAVRSSFAAMQLERGERCDFPLYPTGCLRPALIQLRNYV 134
            L ASM     LDA DP+  ++ A + + R E  +F   PT CL   ++   N V
Sbjct: 1542 LRASMEG--FLDAYDPSTSATPAGVFVNRVEESEFECVPT-CLMDNVLSFLNDV 1592


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.325    0.135    0.410 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,785,780
Number of Sequences: 28952
Number of extensions: 70414
Number of successful extensions: 182
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 182
Number of HSP's gapped (non-prelim): 1
length of query: 188
length of database: 12,070,560
effective HSP length: 77
effective length of query: 111
effective length of database: 9,841,256
effective search space: 1092379416
effective search space used: 1092379416
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 57 (27.1 bits)