BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001040-TA|BGIBMGA001040-PA|undefined
(188 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_Q5T9L3 Cluster: Integral membrane protein GPR177 precur... 35 1.0
>UniRef50_Q5T9L3 Cluster: Integral membrane protein GPR177
precursor; n=40; Euteleostomi|Rep: Integral membrane
protein GPR177 precursor - Homo sapiens (Human)
Length = 541
Score = 35.1 bits (77), Expect = 1.0
Identities = 14/35 (40%), Positives = 22/35 (62%)
Query: 3 YYFWTSDLGVELSSSVLFIAGALLCLPTCWLSTLV 37
Y WT+D+G EL+ + + +AG LCL +L +V
Sbjct: 366 YSIWTTDIGTELAMAFIIVAGICLCLYFLFLCFMV 400
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.325 0.135 0.410
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 133,111,800
Number of Sequences: 1657284
Number of extensions: 3368797
Number of successful extensions: 8964
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 8963
Number of HSP's gapped (non-prelim): 1
length of query: 188
length of database: 575,637,011
effective HSP length: 96
effective length of query: 92
effective length of database: 416,537,747
effective search space: 38321472724
effective search space used: 38321472724
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 69 (31.9 bits)
- SilkBase 1999-2023 -