GeneModel BLAST Result against uniref50

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001040-TA|BGIBMGA001040-PA|undefined
         (188 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q5T9L3 Cluster: Integral membrane protein GPR177 precur...    35   1.0  

>UniRef50_Q5T9L3 Cluster: Integral membrane protein GPR177
           precursor; n=40; Euteleostomi|Rep: Integral membrane
           protein GPR177 precursor - Homo sapiens (Human)
          Length = 541

 Score = 35.1 bits (77), Expect = 1.0
 Identities = 14/35 (40%), Positives = 22/35 (62%)

Query: 3   YYFWTSDLGVELSSSVLFIAGALLCLPTCWLSTLV 37
           Y  WT+D+G EL+ + + +AG  LCL   +L  +V
Sbjct: 366 YSIWTTDIGTELAMAFIIVAGICLCLYFLFLCFMV 400


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.325    0.135    0.410 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 133,111,800
Number of Sequences: 1657284
Number of extensions: 3368797
Number of successful extensions: 8964
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 8963
Number of HSP's gapped (non-prelim): 1
length of query: 188
length of database: 575,637,011
effective HSP length: 96
effective length of query: 92
effective length of database: 416,537,747
effective search space: 38321472724
effective search space used: 38321472724
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 69 (31.9 bits)