BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001040-TA|BGIBMGA001040-PA|undefined (188 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5T9L3 Cluster: Integral membrane protein GPR177 precur... 35 1.0 >UniRef50_Q5T9L3 Cluster: Integral membrane protein GPR177 precursor; n=40; Euteleostomi|Rep: Integral membrane protein GPR177 precursor - Homo sapiens (Human) Length = 541 Score = 35.1 bits (77), Expect = 1.0 Identities = 14/35 (40%), Positives = 22/35 (62%) Query: 3 YYFWTSDLGVELSSSVLFIAGALLCLPTCWLSTLV 37 Y WT+D+G EL+ + + +AG LCL +L +V Sbjct: 366 YSIWTTDIGTELAMAFIIVAGICLCLYFLFLCFMV 400 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.325 0.135 0.410 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,111,800 Number of Sequences: 1657284 Number of extensions: 3368797 Number of successful extensions: 8964 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8963 Number of HSP's gapped (non-prelim): 1 length of query: 188 length of database: 575,637,011 effective HSP length: 96 effective length of query: 92 effective length of database: 416,537,747 effective search space: 38321472724 effective search space used: 38321472724 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 69 (31.9 bits)
- SilkBase 1999-2023 -