BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001040-TA|BGIBMGA001040-PA|undefined (188 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55062| Best HMM Match : MFS_1 (HMM E-Value=0.016) 28 5.5 SB_55843| Best HMM Match : Aa_trans (HMM E-Value=0.00091) 27 9.6 >SB_55062| Best HMM Match : MFS_1 (HMM E-Value=0.016) Length = 556 Score = 27.9 bits (59), Expect = 5.5 Identities = 11/34 (32%), Positives = 22/34 (64%) Query: 1 MSYYFWTSDLGVELSSSVLFIAGALLCLPTCWLS 34 ++ + +TS +G+ ++ +F+AGA C P +LS Sbjct: 134 LAAFHFTSHMGIPINCVFMFLAGACNCGPDPYLS 167 >SB_55843| Best HMM Match : Aa_trans (HMM E-Value=0.00091) Length = 281 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/23 (47%), Positives = 16/23 (69%) Query: 14 LSSSVLFIAGALLCLPTCWLSTL 36 ++ +L +A ALLCLP +L TL Sbjct: 111 VTQELLTVAAALLCLPLVYLKTL 133 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.325 0.135 0.410 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,998,030 Number of Sequences: 59808 Number of extensions: 97444 Number of successful extensions: 256 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 254 Number of HSP's gapped (non-prelim): 2 length of query: 188 length of database: 16,821,457 effective HSP length: 78 effective length of query: 110 effective length of database: 12,156,433 effective search space: 1337207630 effective search space used: 1337207630 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -