BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001039-TA|BGIBMGA001039-PA|IPR000301|CD9/CD37/CD63 antigen, IPR008952|Tetraspanin (249 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 25 0.72 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 6.7 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 24.6 bits (51), Expect = 0.72 Identities = 9/30 (30%), Positives = 14/30 (46%) Query: 161 PYYGVKHEYTKSWDDTQTYLQCCGVKSPND 190 P+Y + H T Q Y + C +P+D Sbjct: 25 PHYNIHHGATPPQSPNQQYTKDCSSPTPSD 54 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Query: 21 KETKTAMLWRRVMGMGGAM 39 + KT M W + G GG M Sbjct: 837 RSLKTKMAWLKEEGFGGIM 855 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.322 0.134 0.435 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 52,011 Number of Sequences: 317 Number of extensions: 1957 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 249 length of database: 114,650 effective HSP length: 55 effective length of query: 194 effective length of database: 97,215 effective search space: 18859710 effective search space used: 18859710 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -