GeneModel BLAST Result against spombe

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001039-TA|BGIBMGA001039-PA|IPR000301|CD9/CD37/CD63
antigen, IPR008952|Tetraspanin
         (249 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC3H8.02 |||sec14 cytosolic factor family|Schizosaccharomyces ...    29   0.84 

>SPAC3H8.02 |||sec14 cytosolic factor family|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 444

 Score = 28.7 bits (61), Expect = 0.84
 Identities = 14/53 (26%), Positives = 25/53 (47%), Gaps = 4/53 (7%)

Query: 166 KHEYTKSWDDTQTYLQCCGVKS----PNDWHGNLPESCCREAYPGKRIDCKSN 214
           K ++T+++ D Q Y+    +      PN W    PE C  EA   K ++ + +
Sbjct: 299 KVKFTRNYRDLQQYINPDNILKEFGGPNPWRYTYPEPCQNEAEALKNVEARKS 351


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.322    0.134    0.435 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 994,762
Number of Sequences: 5004
Number of extensions: 35757
Number of successful extensions: 62
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 62
Number of HSP's gapped (non-prelim): 1
length of query: 249
length of database: 2,362,478
effective HSP length: 71
effective length of query: 178
effective length of database: 2,007,194
effective search space: 357280532
effective search space used: 357280532
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 53 (25.4 bits)