BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001039-TA|BGIBMGA001039-PA|IPR000301|CD9/CD37/CD63 antigen, IPR008952|Tetraspanin (249 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 46 3e-07 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 21 8.0 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 46.0 bits (104), Expect = 3e-07 Identities = 33/127 (25%), Positives = 49/127 (38%), Gaps = 10/127 (7%) Query: 104 LSLLGCCGAAKEVKCMLLTYYXXXXXXXXXXXXXXXXQFVF--REKVLTTLDRELYASVP 161 +S GCCGA +E CM +T+ F+ + + + Sbjct: 65 ISFFGCCGAIRESHCMTITFASFLLFILLVQIAVAVYAFIVVKNDDNFRNISEKYQEIFN 124 Query: 162 YYGVKHEYTKSWDDTQTYLQCCGVKSPNDWHGN-LPESCCREAYPGKRIDCKSNQNPTTI 220 Y + E D Q LQCCGV S +D++ +P SCC P SN Sbjct: 125 GYFLNSESKDFIDFIQKNLQCCGVHSLSDYNDKPIPASCCNS--PENNTCSISNS----- 177 Query: 221 YVDGCLD 227 Y +GC++ Sbjct: 178 YTNGCVE 184 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.4 bits (43), Expect = 8.0 Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Query: 198 SCCREAYPGKRIDCKSNQNPTTIYVDGCLDKVIEFLREDAVYVVLLPSLS 247 SCC E YP + + + P YV + I + A+ V +PS S Sbjct: 194 SCCPEPYPDITYEIRLRRRP-MFYVFNLILPCI-LINSVALLVFYVPSES 241 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.322 0.134 0.435 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,915 Number of Sequences: 429 Number of extensions: 2438 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 249 length of database: 140,377 effective HSP length: 56 effective length of query: 193 effective length of database: 116,353 effective search space: 22456129 effective search space used: 22456129 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -