BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001037-TA|BGIBMGA001037-PA|IPR001412|Aminoacyl-tRNA synthetase, class I, IPR002300|Aminoacyl-tRNA synthetase, class Ia, IPR002308|Cysteinyl-tRNA synthetase, class Ia, IPR013155|tRNA synthetase, valyl/leucyl, anticodon-binding, IPR004493|Leucyl-tRNA synthetase archae/euk cytosolic, class Ia, IPR009080|Aminoacyl-tRNA synthetase, class 1a, anticodon-binding (1198 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 26 6.8 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.8 bits (54), Expect = 6.8 Identities = 29/99 (29%), Positives = 47/99 (47%), Gaps = 16/99 (16%) Query: 452 LYDELKIQSQNDREKLTQAKEMVYLKGFYDGVLLVGEHKGSKIQDVKKNLQTKL---IQE 508 LY + ++Q RE+ T A + DG ++ EHKG K K LQ + + Sbjct: 2492 LYRQQFDRAQGGREEFTMAHDS-------DGAVIQAEHKGIKHMAYDKLLQRVSEIEMTD 2544 Query: 509 GKAVIY-YE--PEKTIIS-RSGDECVVALCNQWYLDYGN 543 G+ ++Y Y+ E+T R+ DE V L ++Y+ N Sbjct: 2545 GRKILYQYDVRAERTFKQVRAKDETV--LSEKYYIRDAN 2581 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.135 0.413 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,206,275 Number of Sequences: 2123 Number of extensions: 48061 Number of successful extensions: 190 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 190 Number of HSP's gapped (non-prelim): 1 length of query: 1198 length of database: 516,269 effective HSP length: 72 effective length of query: 1126 effective length of database: 363,413 effective search space: 409203038 effective search space used: 409203038 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -