BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001035-TA|BGIBMGA001035-PA|IPR000644|CBS, IPR001093|IMP dehydrogenase/GMP reductase, IPR005990|IMP dehydrogenase (512 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 25 1.5 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 23 8.0 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 25.0 bits (52), Expect = 1.5 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 4/38 (10%) Query: 359 GGIQSVGHII-KSLALGASTVMMGSLLAGTSEAPGEYF 395 GGI+ + HII K L + S V+MG+ LA SE E F Sbjct: 129 GGIELISHIISKQLHIPVS-VLMGANLA--SEVANEMF 163 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 22.6 bits (46), Expect = 8.0 Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 3/25 (12%) Query: 241 GAAIGTRDTDRERLKLLVNNGVDVI 265 G+ I TR ER++L NG+DV+ Sbjct: 324 GSVINTRG---ERIQLTEKNGIDVL 345 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.317 0.135 0.382 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,795 Number of Sequences: 429 Number of extensions: 6142 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 2 length of query: 512 length of database: 140,377 effective HSP length: 61 effective length of query: 451 effective length of database: 114,208 effective search space: 51507808 effective search space used: 51507808 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -