BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001032-TA|BGIBMGA001032-PA|IPR001452|Src homology-3, IPR001683|Phox-like (558 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family p... 24 3.8 >AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family protein protein. Length = 166 Score = 23.8 bits (49), Expect = 3.8 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 4/47 (8%) Query: 347 VPEKALL-QSQVDHITEQCHTFINSVDTAIKSVSSMCIVQTKRFQGP 392 VP + L +S++ T+Q FI+++D SV+SM +Q KR GP Sbjct: 97 VPNTSRLDKSEISLATKQACGFIDNIDKRNLSVTSM--IQ-KRALGP 140 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.133 0.394 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,718 Number of Sequences: 429 Number of extensions: 6700 Number of successful extensions: 10 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 1 length of query: 558 length of database: 140,377 effective HSP length: 61 effective length of query: 497 effective length of database: 114,208 effective search space: 56761376 effective search space used: 56761376 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -