BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001032-TA|BGIBMGA001032-PA|IPR001452|Src homology-3, IPR001683|Phox-like (558 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 24 2.4 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 23 4.2 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 24.2 bits (50), Expect = 2.4 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 4/54 (7%) Query: 139 PGMPINDYNQHIDDTSSNYSSSVGTVRKNKFAPSSKISGESYLLATLNVEVPDS 192 PG P + Y S+ YSS + + + ++P+ KI E ++LN DS Sbjct: 121 PGPPSHPYTV----ISNGYSSPMSSGSYDPYSPNGKIGREDLSPSSLNGYSADS 170 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 23.4 bits (48), Expect = 4.2 Identities = 24/120 (20%), Positives = 48/120 (40%), Gaps = 9/120 (7%) Query: 204 YIWSPITQPYIVTVASPKKESKFKGIKSFIAYQLTPSFNNIQVSRRYKHFDWLHER---L 260 Y +P+T P + SPK E + K +++ + +P+ + + E+ Sbjct: 101 YNHNPLTPPNSEPLVSPKSEKEEKDMETTLTPCASPNRKPDDNQDHLRRLEMSLEKSGLF 160 Query: 261 QEKFTLIPIPPLPDKQISG--RYDEQLIERRRV----QLQEFVDWMCKHPVLSRSEVWQH 314 K + + L K + YDEQ + +V +++ F C +++ E W H Sbjct: 161 SSKTSEHSVDELSGKSDNDAEEYDEQSLRVPKVNSHGKIKTFKCKQCDFVAITKLEQWNH 220 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.133 0.394 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,582 Number of Sequences: 317 Number of extensions: 5352 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 2 length of query: 558 length of database: 114,650 effective HSP length: 60 effective length of query: 498 effective length of database: 95,630 effective search space: 47623740 effective search space used: 47623740 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -