BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001032-TA|BGIBMGA001032-PA|IPR001452|Src homology-3,
IPR001683|Phox-like
(558 letters)
Database: bee
429 sequences; 140,377 total letters
Searching.....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family p... 24 3.8
>AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family
protein protein.
Length = 166
Score = 23.8 bits (49), Expect = 3.8
Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 4/47 (8%)
Query: 347 VPEKALL-QSQVDHITEQCHTFINSVDTAIKSVSSMCIVQTKRFQGP 392
VP + L +S++ T+Q FI+++D SV+SM +Q KR GP
Sbjct: 97 VPNTSRLDKSEISLATKQACGFIDNIDKRNLSVTSM--IQ-KRALGP 140
Database: bee
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 140,377
Number of sequences in database: 429
Lambda K H
0.316 0.133 0.394
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 157,718
Number of Sequences: 429
Number of extensions: 6700
Number of successful extensions: 10
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 10
Number of HSP's gapped (non-prelim): 1
length of query: 558
length of database: 140,377
effective HSP length: 61
effective length of query: 497
effective length of database: 114,208
effective search space: 56761376
effective search space used: 56761376
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 46 (22.6 bits)
- SilkBase 1999-2023 -