SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001031-TA|BGIBMGA001031-PA|IPR001978|Troponin
         (332 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein.    24   6.8  

>AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein.
          Length = 1229

 Score = 23.8 bits (49), Expect = 6.8
 Identities = 11/44 (25%), Positives = 24/44 (54%)

Query: 59  YENKFAKLQKKAAEFNFRNQLKVVKKKEFTLEEEDKEKKPDWSK 102
           Y N+    + K  + + + +L +++K++   +E  KEKK +  K
Sbjct: 239 YHNEKEAKRLKEDQISKQQELNIIEKRKEEADEVLKEKKKEVGK 282


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.319    0.135    0.391 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 221,295
Number of Sequences: 2123
Number of extensions: 6255
Number of successful extensions: 13
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 12
Number of HSP's gapped (non-prelim): 1
length of query: 332
length of database: 516,269
effective HSP length: 64
effective length of query: 268
effective length of database: 380,397
effective search space: 101946396
effective search space used: 101946396
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 48 (23.4 bits)

- SilkBase 1999-2023 -