BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001030-TA|BGIBMGA001030-PA|IPR001978|Troponin (130 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 25 0.21 M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-... 21 4.4 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 25.4 bits (53), Expect = 0.21 Identities = 12/46 (26%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Query: 83 GKPKNIDDANEDTIKRVCKDYHER--IARLEDEKFDLEYIVKRKDM 126 G KN D N +T+ R + Y++R +A+++ ++ +++ KD+ Sbjct: 501 GLHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQFVDVPKDI 546 >M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H17. ). Length = 79 Score = 21.0 bits (42), Expect = 4.4 Identities = 8/15 (53%), Positives = 13/15 (86%) Query: 8 AKAKKAKQAEIDRKR 22 AKAK+ ++AEI++ R Sbjct: 62 AKAKRLQEAEIEKLR 76 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.133 0.378 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,163 Number of Sequences: 429 Number of extensions: 533 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 130 length of database: 140,377 effective HSP length: 51 effective length of query: 79 effective length of database: 118,498 effective search space: 9361342 effective search space used: 9361342 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.1 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -