BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001029-TA|BGIBMGA001029-PA|undefined (199 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 27 0.077 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 1.7 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 27.5 bits (58), Expect = 0.077 Identities = 15/67 (22%), Positives = 31/67 (46%) Query: 79 EITATPPAGRKVPDCRAPTVQDFFIDRMITVDTAGWEPVFSLMHQLAEMFNFYDYTTLGS 138 ++ AT G +V + P + + + R +T +A L H + ++ F++Y L Sbjct: 137 DVIATAAFGIRVNSVQEPNNEFYAMGRSLTTFSAFQILKIFLAHLVPKIAEFFEYRVLPR 196 Query: 139 KIAKYVE 145 K+ + E Sbjct: 197 KVTDFFE 203 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.0 bits (47), Expect = 1.7 Identities = 11/28 (39%), Positives = 14/28 (50%) Query: 25 SLNVCGKDGCYSEIQLDNILLEEEDCSN 52 S VC D Y EI+ I E++ C N Sbjct: 773 SCTVCTCDAKYLEIKCKRIYNEKQCCKN 800 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.133 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 39,149 Number of Sequences: 317 Number of extensions: 1493 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 199 length of database: 114,650 effective HSP length: 54 effective length of query: 145 effective length of database: 97,532 effective search space: 14142140 effective search space used: 14142140 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -