BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001029-TA|BGIBMGA001029-PA|undefined (199 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0246 - 16024454-16024529,16024635-16024720,16024805-160248... 28 5.9 01_05_0740 - 24809951-24810394,24810622-24810700,24811651-248118... 28 5.9 >09_04_0246 - 16024454-16024529,16024635-16024720,16024805-16024894, 16025349-16025435,16026112-16026229,16026852-16026982, 16027619-16027909,16028000-16028124,16028209-16028334, 16028452-16028487,16028599-16028902 Length = 489 Score = 27.9 bits (59), Expect = 5.9 Identities = 23/76 (30%), Positives = 30/76 (39%), Gaps = 4/76 (5%) Query: 40 LDNILLEEEDCSNQHLQLSYWLHVSFRQMLSEADLGLVQEITATPPAGRKVPDCRAPTVQ 99 +DN L E+ ++L+ WL RQ L E + EI PP R D P V Sbjct: 65 VDNALKIREELHQKYLRAEPWLKEQERQRL-ERNKRFTTEIINQPPDYRGEWD---PYVS 120 Query: 100 DFFIDRMITVDTAGWE 115 D + GWE Sbjct: 121 DDEFGTSFELKRTGWE 136 >01_05_0740 - 24809951-24810394,24810622-24810700,24811651-24811809, 24812083-24812246,24812436-24812624,24813151-24813408, 24813463-24813951,24814062-24814262,24814368-24814639, 24814661-24814685,24814776-24814937,24815065-24815104, 24815244-24815353,24815812-24815898,24816013-24816507 Length = 1057 Score = 27.9 bits (59), Expect = 5.9 Identities = 13/36 (36%), Positives = 21/36 (58%) Query: 45 LEEEDCSNQHLQLSYWLHVSFRQMLSEADLGLVQEI 80 LEEE+ +HLQ+S W+ + + SE G +E+ Sbjct: 623 LEEEEFWKEHLQVSGWIDIMQLKERSEQPHGTWEEV 658 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.320 0.133 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,846,229 Number of Sequences: 37544 Number of extensions: 168681 Number of successful extensions: 346 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 345 Number of HSP's gapped (non-prelim): 2 length of query: 199 length of database: 14,793,348 effective HSP length: 78 effective length of query: 121 effective length of database: 11,864,916 effective search space: 1435654836 effective search space used: 1435654836 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -