Silkworm BLAST Result against nematostella

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001029-TA|BGIBMGA001029-PA|undefined
         (199 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27)                   29   2.0  

>SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27)
          Length = 5087

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 1/61 (1%)

Query: 71  EADLGLVQEITATPPAGRKVPDCRAP-TVQDFFIDRMITVDTAGWEPVFSLMHQLAEMFN 129
           E +L + Q I    PA    PD R P ++    ID++ T+  AG EP     H L+++  
Sbjct: 192 EVELHVEQVIVFCEPAQLTTPDVRRPLSLDSEGIDKITTLSFAGTEPEQHEGHVLSKVAF 251

Query: 130 F 130
           F
Sbjct: 252 F 252


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.320    0.133    0.405 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 5,484,325
Number of Sequences: 59808
Number of extensions: 189176
Number of successful extensions: 371
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 371
Number of HSP's gapped (non-prelim): 2
length of query: 199
length of database: 16,821,457
effective HSP length: 79
effective length of query: 120
effective length of database: 12,096,625
effective search space: 1451595000
effective search space used: 1451595000
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 58 (27.5 bits)