BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001029-TA|BGIBMGA001029-PA|undefined (199 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 29 2.0 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 29.5 bits (63), Expect = 2.0 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Query: 71 EADLGLVQEITATPPAGRKVPDCRAP-TVQDFFIDRMITVDTAGWEPVFSLMHQLAEMFN 129 E +L + Q I PA PD R P ++ ID++ T+ AG EP H L+++ Sbjct: 192 EVELHVEQVIVFCEPAQLTTPDVRRPLSLDSEGIDKITTLSFAGTEPEQHEGHVLSKVAF 251 Query: 130 F 130 F Sbjct: 252 F 252 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.320 0.133 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,484,325 Number of Sequences: 59808 Number of extensions: 189176 Number of successful extensions: 371 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 371 Number of HSP's gapped (non-prelim): 2 length of query: 199 length of database: 16,821,457 effective HSP length: 79 effective length of query: 120 effective length of database: 12,096,625 effective search space: 1451595000 effective search space used: 1451595000 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -