Silkworm BLAST Result against human

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001029-TA|BGIBMGA001029-PA|undefined
         (199 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L19184-1|AAA50464.1|  199|Homo sapiens enhancer protein protein.       31   2.0  

>L19184-1|AAA50464.1|  199|Homo sapiens enhancer protein protein.
          Length = 199

 Score = 31.5 bits (68), Expect = 2.0
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 63  VSFRQMLSEADLGLVQEITAT-PPAGRKVPDCRAPTVQDF-FIDRMITVDTAGWEP 116
           +SFR +    D G++++IT   PP  R V D     VQ F F D+   V  AGW+P
Sbjct: 125 ISFRGLFIIDDKGILRQITVNDPPCCRSV-DETLRLVQAFQFTDKHGEVCPAGWKP 179


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.320    0.133    0.405 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,816,389
Number of Sequences: 224733
Number of extensions: 889421
Number of successful extensions: 1506
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1506
Number of HSP's gapped (non-prelim): 1
length of query: 199
length of database: 73,234,838
effective HSP length: 86
effective length of query: 113
effective length of database: 53,907,800
effective search space: 6091581400
effective search space used: 6091581400
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 63 (29.5 bits)