BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001029-TA|BGIBMGA001029-PA|undefined (199 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U61958-2|AAB03182.3| 1067|Caenorhabditis elegans Hypothetical pr... 32 0.32 AF016686-1|AAB66240.1| 399|Caenorhabditis elegans Hypothetical ... 30 1.3 >U61958-2|AAB03182.3| 1067|Caenorhabditis elegans Hypothetical protein C25A8.4 protein. Length = 1067 Score = 31.9 bits (69), Expect = 0.32 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 8/80 (10%) Query: 75 GLVQEITATPPAGRKVPDCRAPTVQDF-------FIDRMITVDTAGWEPVFSLMHQLAEM 127 GLV+ I +T G ++ P V DF FI+ ++ DTA + Q + Sbjct: 469 GLVKAINSTNADGLEISWTSQPMVSDFDKKNLKSFINDIVAADTAKMVEIVVATSQQSAY 528 Query: 128 FNFYDYTTLGSKIAKYVESH 147 +FYDY L +K A + H Sbjct: 529 SDFYDYEHL-NKTASLIVLH 547 >AF016686-1|AAB66240.1| 399|Caenorhabditis elegans Hypothetical protein R07C3.11 protein. Length = 399 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/23 (56%), Positives = 16/23 (69%) Query: 41 DNILLEEEDCSNQHLQLSYWLHV 63 D ILL+ D SN HL+LSY L + Sbjct: 83 DTILLDNRDPSNMHLELSYELQL 105 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.320 0.133 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,133,362 Number of Sequences: 27539 Number of extensions: 148532 Number of successful extensions: 353 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 351 Number of HSP's gapped (non-prelim): 2 length of query: 199 length of database: 12,573,161 effective HSP length: 78 effective length of query: 121 effective length of database: 10,425,119 effective search space: 1261439399 effective search space used: 1261439399 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -