BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001029-TA|BGIBMGA001029-PA|undefined (199 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A1FVF7 Cluster: Methyltransferase type 12; n=1; Stenotr... 34 2.7 UniRef50_Q2SL99 Cluster: Outer membrane lipoprotein LolB; n=1; H... 33 4.6 UniRef50_A7PGE3 Cluster: Chromosome chr6 scaffold_15, whole geno... 33 4.6 >UniRef50_A1FVF7 Cluster: Methyltransferase type 12; n=1; Stenotrophomonas maltophilia R551-3|Rep: Methyltransferase type 12 - Stenotrophomonas maltophilia R551-3 Length = 746 Score = 33.9 bits (74), Expect = 2.7 Identities = 29/90 (32%), Positives = 38/90 (42%), Gaps = 4/90 (4%) Query: 37 EIQLDNILLEEEDCSNQHLQLSYWLHVSFRQML-SEADLGLVQEITATPPAGRKVPDCRA 95 E++ LE +NQHLQ L RQ+L S D G + + A P G A Sbjct: 353 ELEQAQARLEAAQSANQHLQWQQGLREQVRQVLSSRTDEGAMPYLDA-PVGGSASVGQPA 411 Query: 96 PTVQDFFI--DRMITVDTAGWEPVFSLMHQ 123 P+V +F D G E V +MHQ Sbjct: 412 PSVYEFNARRDLRFAQTVVGHERVCHIMHQ 441 >UniRef50_Q2SL99 Cluster: Outer membrane lipoprotein LolB; n=1; Hahella chejuensis KCTC 2396|Rep: Outer membrane lipoprotein LolB - Hahella chejuensis (strain KCTC 2396) Length = 206 Score = 33.1 bits (72), Expect = 4.6 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 2/77 (2%) Query: 67 QMLSEADLGLVQEITATPPAGRKVPDCRAPTVQDFFID-RMITVDTAGWEPVFSLMHQLA 125 Q L E LG I + P R VPD R P F +D +I+++ GW +S Q+ Sbjct: 121 QQLLEHALGWSIPIESLPYWVRGVPDVREPNQLTFSVDGELISIEQNGWLVEYSRFKQVG 180 Query: 126 EMFNFYDYTTLGSKIAK 142 ++ + + TL S+ A+ Sbjct: 181 DL-SLPEKITLTSEDAR 196 >UniRef50_A7PGE3 Cluster: Chromosome chr6 scaffold_15, whole genome shotgun sequence; n=5; core eudicotyledons|Rep: Chromosome chr6 scaffold_15, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 728 Score = 33.1 bits (72), Expect = 4.6 Identities = 25/78 (32%), Positives = 38/78 (48%), Gaps = 4/78 (5%) Query: 13 KNYDAM-LRTMDKSLNVCGKDGCYSEIQLDNILLEEEDCSNQHLQLSYWLHV--SFRQML 69 K+Y A+ L+T+ K C KD ++I+ + L EEDCS ++ S V RQ Sbjct: 330 KSYTALALQTISKQFR-CLKDAISAQIKATSSSLGEEDCSGGKVEGSRLRFVDHQLRQQR 388 Query: 70 SEADLGLVQEITATPPAG 87 + LG++Q P G Sbjct: 389 ALQQLGMIQHNAWRPQRG 406 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.320 0.133 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,421,395 Number of Sequences: 1657284 Number of extensions: 6346767 Number of successful extensions: 13012 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 13012 Number of HSP's gapped (non-prelim): 3 length of query: 199 length of database: 575,637,011 effective HSP length: 97 effective length of query: 102 effective length of database: 414,880,463 effective search space: 42317807226 effective search space used: 42317807226 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 70 (32.3 bits)
- SilkBase 1999-2023 -