BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001029-TA|BGIBMGA001029-PA|undefined
(199 letters)
Database: nematostella
59,808 sequences; 16,821,457 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 29 2.0
>SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27)
Length = 5087
Score = 29.5 bits (63), Expect = 2.0
Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
Query: 71 EADLGLVQEITATPPAGRKVPDCRAP-TVQDFFIDRMITVDTAGWEPVFSLMHQLAEMFN 129
E +L + Q I PA PD R P ++ ID++ T+ AG EP H L+++
Sbjct: 192 EVELHVEQVIVFCEPAQLTTPDVRRPLSLDSEGIDKITTLSFAGTEPEQHEGHVLSKVAF 251
Query: 130 F 130
F
Sbjct: 252 F 252
Database: nematostella
Posted date: Oct 22, 2007 1:22 PM
Number of letters in database: 16,821,457
Number of sequences in database: 59,808
Lambda K H
0.320 0.133 0.405
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 5,484,325
Number of Sequences: 59808
Number of extensions: 189176
Number of successful extensions: 371
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 371
Number of HSP's gapped (non-prelim): 2
length of query: 199
length of database: 16,821,457
effective HSP length: 79
effective length of query: 120
effective length of database: 12,096,625
effective search space: 1451595000
effective search space used: 1451595000
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 58 (27.5 bits)
- SilkBase 1999-2023 -