GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001026-TA|BGIBMGA001026-PA|IPR001320|Ionotropic
glutamate receptor
         (496 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U09586-2|AAC47271.1|  712|Tribolium castaneum protease, reverse ...    25   0.92 

>U09586-2|AAC47271.1|  712|Tribolium castaneum protease, reverse
           transcriptase andRNase H protein.
          Length = 712

 Score = 25.4 bits (53), Expect = 0.92
 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 4/34 (11%)

Query: 325 PFMKKPRAFVYPVGSKLKSLFDPTLAYILQSGII 358
           PF+K+P    YPV   L+   D T+  +L  G+I
Sbjct: 305 PFLKRP----YPVPFALRPAVDATIQEMLDLGVI 334


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.323    0.138    0.420 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 117,865
Number of Sequences: 317
Number of extensions: 5011
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2
Number of HSP's gapped (non-prelim): 1
length of query: 496
length of database: 114,650
effective HSP length: 60
effective length of query: 436
effective length of database: 95,630
effective search space: 41694680
effective search space used: 41694680
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 45 (22.2 bits)